You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

nmt55 / p54nrb protein (Tagged-His Tag) (ab91870)

Submit an Abreview Submit a Question

Overview

  • Product namenmt55 / p54nrb protein (Tagged-His Tag)See all nmt55 / p54nrb proteins and peptides ...
  • Protein descriptionRecombinant fragment, corresponding to amino acids 185-471 (287 amino acids) of Human nmt55 / p54nrb with N terminal His tag; MWt 36kDa (UniProt Q15233).
  • Expression hostE. coli

    • Properties

  • Purification notesPurity level >85%
    This protein was expressed as an N-terminal His-tag fusion protein using Escherichia coli, and purified using Immobilized Metal Ion Affinity Chromatography. In some cases, smaller protein fragments may be present in addition to the intended expression product as a result of premature termination during translation in E. coli and subsequent co-purification via the His-tag. In some cases purified proteins run at a molecular weight different to the theoretically calculated molecular weight. This may be as a result of unequally distributed charges in the amino acid sequence. Alternatively, dimerisation of the expression product can occur under oxygen limitation during expression/cultivation.
  • FormLyophilised:Reconstitute with 113 µl aqua dest.
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
  • Concentration information loading...
  • Additional notesProtein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch)
  • Sequence notesGRPSGKGIVEFSGKPAARKALDRCSEGSFLLTTFPRPVTV EPMDQLDD EEGLPEKLVIKNQQFHKEREQPPRFAQPGS FEYEYAMRWKALIEMEKQ QQDQVDRNIKEAREKLEMEM EAARHEHQVMLMRQDLMRRQEELRRMEE LHNQEVQKRK QLELRQEEERRRREEEMRRQQEEMMRRQQEGFKGTFPD AREQEIRMGQMAMGGAMGINNRGAMPPAPVPAGTPAPPGP ATMMPDGT LGLTPPTTERFGQAATMEGIGAIGGTPPAF NRAAPGAEFAPNKRRRY
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab91870 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    SDS-PAGE
    MS
  • Application notesMS: Use at an assay dependent dilution.
    SDS-PAGE: Use at an assay dependent dilution.


    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.

    • Protein info

    • Alternative names
        52 kDa subunit54 kDa nuclear RNA and DNA binding protein54 kDa nuclear RNA- and DNA-binding protein
        55 kDa nuclear proteinDNA binding p52/p100 complex 52 kDa subunitDNA-binding p52/p100 complexNMT 55NMT55Non Pou domain containing octamer (ATGCAAAT) binding proteinNon POU domain containing octamer bindingNon POU domain containing octamer binding proteinNon-POU domain-containing octamer-binding proteinNONONonO proteinNONO_HUMANNRBNRB 54NRB54Nuclear RNA binding protein 54kDP54p54(nrb)p54nrb
      see all
  • FunctionDNA- and RNA binding protein, involved in several nuclear processes. Binds the conventional octamer sequence in double stranded DNA. Also binds single-stranded DNA and RNA at a site independent of the duplex site (By similarity). Involved in pre-mRNA splicing, probably as an heterodimer with SFPQ. Interacts with U5 snRNA, probably by binding to a purine-rich sequence located on the 3' side of U5 snRNA stem 1b. The SFPQ-NONO heteromer associated with MATR3 may play a role in nuclear retention of defective RNAs. The SFPQ-NONO heteromer may be involved in DNA unwinding by modulating the function of topoisomerase I/TOP1. The SFPQ-NONO heteromer may be involved in DNA nonhomologous end joining (NHEJ) required for double-strand break repair and V(D)J recombination and may stabilize paired DNA ends. In vitro, the complex strongly stimulates DNA end joining, binds directly to the DNA substrates and cooperates with the Ku70/G22P1-Ku80/XRCC5 (Ku) dimer to establish a functional preligation complex. Nono is involved in transcriptional regulation. The SFPQ-NONO-NR5A1 complex binds to the CYP17 promoter and regulates basal and cAMP-dependent transcriptional avtivity. NONO binds to an enhancer element in long terminal repeats of endogenous intracisternal A particles (IAPs) and activates transcription.
  • Tissue specificityHeart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Also found in a number of breast tumor cell lines.
  • Involvement in diseaseNote=A chromosomal aberration involving NONO may be a cause of papillary renal cell carcinoma (PRCC). Translocation t(X;X)(p11.2;q13.1) with TFE3.
  • Sequence similaritiesContains 2 RRM (RNA recognition motif) domains.
  • Post-translational
    modifications    The N-terminus is blocked.
  • Cellular localizationNucleus.

    • Target information above from: UniProt accession Q15233 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    nmt55 / p54nrb protein (Tagged-His Tag) images

    • SDS-PAGE - nmt55 / p54nrb protein (Tagged-His Tag) (ab91870)
      SDS-PAGE - nmt55 / p54nrb protein (Tagged-His Tag) (ab91870)
      The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

    References for nmt55 / p54nrb protein (Tagged-His Tag) (ab91870)

    ab91870 has not yet been referenced specifically in any publications.

    Publishing research using ab91870 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab91870 Submit a Question for ab91870

    There are currently no Abreviews or Questions for ab91870.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"