Overview

  • Product name
    Anti-Nogo Receptor antibody
    See all Nogo Receptor primary antibodies
  • Description
    Mouse polyclonal to Nogo Receptor
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cynomolgus monkey
  • Immunogen

    Full length protein corresponding to Human Nogo Receptor aa 1-473.
    Sequence:

    MKRASAGGSRLLAWVLWLQAWQVAAPCPGACVCYNEPKVTTSCPQQGLQA VPVGIPAASQRIFLHGNRISHVPAASFRACRNLTILWLHSNVLARIDAAA FTGLALLEQLDLSDNAQLRSVDPATFHGLGRLHTLHLDRCGLQELGPGLF RGLAALQYLYLQDNALQALPDDTFRDLGNLTHLFLHGNRISSVPERAFRG LHSLDRLLLHQNRVAHVHPHAFRDLGRLMTLYLFANNLSALPTEALAPLR ALQYLRLNDNPWVCDCRARPLWAWLQKFRGSSSEVPCSLPQRLAGRDLKR LAANDLQGCAVATGPYHPIWTGRATDEEPLGLPKCCQPDAADKASVLEPG RPASAGNALKGRVPPGDSPPGNGSGPRHINDSPFGTLPGSAEPPLTAVRP EGSEPPGFPTSGPRRRPGCSRKNRTRSHCRLGQAGSGGGGTGDSEGSGAL PSLTCSLTPLGLALVLWTVLGPC


    Database link: NP_075380.1

  • Positive control
    • Nogo Receptor-transfected 293T cell line lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab172653 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 51 kDa.

Target

Images

  • All lanes : Anti-Nogo Receptor antibody (ab172653) at 1 µg/ml

    Lane 1 : Nogo Receptor-transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    Goat Anti-Mouse IgG-HRP at 1/2500 dilution
    Developed using the ECL technique

    Predicted band size : 51 kDa

References

ab172653 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172653.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up