
  • Product name
  • Description
    Rabbit polyclonal to NOL6
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Saccharomyces cerevisiae
  • Immunogen

    Synthetic peptide corresponding to a region within the N terminal amino acids 35-84 (SRKRTLAEPPAKGLLQPVKLSRAELYKEPTNEELNRLRETEILFHSSLL R) of Human NOL6 (NP_075068)

  • Positive control
    • 721_B cell lysate



Our Abpromise guarantee covers the use of ab83967 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 127 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • Relevance
    NOL6 is a nucleolar RNA associated protein that is highly conserved between species. RNase treatment of permeabilized cells indicates that the nucleolar localization is RNA dependent. Further studies suggest that the protein is associated with ribosome biogenesis through an interaction with pre-rRNA primary transcripts.
  • Cellular localization
    Nucleus; nucleolus. Localizes to condensed chromosomes in mitosis
  • Database links
  • Alternative names
    • bA311H10.1 antibody
    • FLJ21959 antibody
    • MGC14896 antibody
    • MGC14921 antibody
    • MGC20838 antibody
    • NRAP antibody
    • Nucleolar protein 6 antibody
    • Nucleolar protein family 6 (RNA associated) antibody
    • Nucleolar RNA associated protein antibody
    • UTP22 antibody
    see all

Anti-NOL6 antibody images

  • Anti-NOL6 antibody (ab83967) at 1 µg/ml + 721_B cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 127 kDa
    Observed band size : 110 kDa (why is the actual band size different from the predicted?)
    Additional bands at : 60 kDa. We are unsure as to the identity of these extra bands.

References for Anti-NOL6 antibody (ab83967)

ab83967 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83967.
Please use the links above to contact us or submit feedback about this product.


Sign up