
  • Product name
  • Description
    Rabbit polyclonal to Noto
  • Host species
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Guinea pig, Cow, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 11-60 (VQPGSLRPCPGAVSPVVPRRLARGRLESSFSVEAILARPKTRELAATSL P) of Mouse Noto (NP_001007473).

  • Positive control
    • Mouse brain lysate



Our Abpromise guarantee covers the use of ab102617 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 26 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • Function
    Transcription regulator acting downstream of both FOXA2 and T during notochord development. Required for node morphogenesis. Is essential for cilia formation in the posterior notochord (PNC) and for left-right patterning; acts upstream of FOXJ1 and RFX3 in this process and is required for the expression of various components important for axonemal assembly and function. Plays a role in regulating axial versus paraxial cell fate.
  • Sequence similarities
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization
  • Information by UniProt
  • Database links
  • Alternative names
    • notochord homolog antibody
    • flh antibody
    • floating head antibody
    • floating head homolog antibody
    • Homeobox protein notochord antibody
    • Not antibody
    • Not homeodomain protein antibody
    • Noto antibody
    • NOTO_HUMAN antibody
    • notochord homeobox antibody
    • notochord homolog (Xenopus laevis) antibody
    • Znot antibody
    see all


  • Anti-Noto antibody (ab102617) at 1 µg/ml + Mouse brain lysate at 10 µg

    Predicted band size: 26 kDa


ab102617 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab102617.
Please use the links above to contact us or submit feedback about this product.


Sign up