
  • Product name
  • Description
    Rabbit polyclonal to Noto
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Guinea pig, Cow, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 11-60 (VQPGSLRPCPGAVSPVVPRRLARGRLESSFSVEAILARPKTRELAATSL P) of Mouse Noto (NP_001007473).

  • Positive control
    • Mouse brain lysate



Our Abpromise guarantee covers the use of ab102617 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 26 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • Function
    Transcription regulator acting downstream of both FOXA2 and T during notochord development. Required for node morphogenesis. Is essential for cilia formation in the posterior notochord (PNC) and for left-right patterning; acts upstream of FOXJ1 and RFX3 in this process and is required for the expression of various components important for axonemal assembly and function. Plays a role in regulating axial versus paraxial cell fate.
  • Sequence similarities
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization
  • Information by UniProt
  • Database links
  • Alternative names
    • notochord homolog antibody
    • flh antibody
    • floating head antibody
    • floating head homolog antibody
    • Homeobox protein notochord antibody
    • Not antibody
    • Not homeodomain protein antibody
    • Noto antibody
    • NOTO_HUMAN antibody
    • notochord homeobox antibody
    • notochord homolog (Xenopus laevis) antibody
    • Znot antibody
    see all

Anti-Noto antibody images

  • Anti-Noto antibody (ab102617) at 1 µg/ml + Mouse brain lysate at 10 µg

    Predicted band size : 26 kDa

References for Anti-Noto antibody (ab102617)

ab102617 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab102617.
Please use the links above to contact us or submit feedback about this product.


Sign up