Overview

  • Product name
    Anti-NOX2/gp91phox antibody
    See all NOX2/gp91phox primary antibodies
  • Description
    Rabbit polyclonal to NOX2/gp91phox
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human NOX2/gp91phox aa 283-570.
    Sequence:

    ERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKV SKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFNACGCDKQEFQDAWKL PKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNAT NLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTG WDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRI GVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF


    Database link: P04839

  • Positive control
    • MCF7 cell line extract.

Properties

Applications

Our Abpromise guarantee covers the use of ab180642 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 65 kDa.

Target

  • Function
    Critical component of the membrane-bound oxidase of phagocytes that generates superoxide. It is the terminal component of a respiratory chain that transfers single electrons from cytoplasmic NADPH across the plasma membrane to molecular oxygen on the exterior. Also functions as a voltage-gated proton channel that mediates the H(+) currents of resting phagocytes. It participates in the regulation of cellular pH and is blocked by zinc.
  • Involvement in disease
    Defects in CYBB are a cause of chronic granulomatous disease X-linked (XCGD) [MIM:306400]. Chronic granulomatous disease is a genetically heterogeneous disorder characterized by the inability of neutrophils and phagocytes to kill microbes that they have ingested. Patients suffer from life-threatening bacterial/fungal infections.
  • Sequence similarities
    Contains 1 FAD-binding FR-type domain.
    Contains 1 ferric oxidoreductase domain.
  • Post-translational
    modifications
    Glycosylated.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • AMCBX2 antibody
    • CGD antibody
    • CGD91-phox antibody
    • CY24B_HUMAN antibody
    • CYBB antibody
    • Cytochrome b 245, beta polypeptide antibody
    • Cytochrome b(558) beta chain antibody
    • Cytochrome b(558) subunit beta antibody
    • Cytochrome b-245 heavy chain antibody
    • Cytochrome b558 subunit beta antibody
    • GP91 PHOX antibody
    • gp91-1 antibody
    • gp91-phox antibody
    • GP91PHOX antibody
    • Heme-binding membrane glycoprotein gp91phox antibody
    • NADPH oxidase 2 antibody
    • Neutrophil cytochrome b 91 kDa polypeptide antibody
    • NOX2 antibody
    • p22 phagocyte B-cytochrome antibody
    • P91 PHOX antibody
    • p91-PHOX antibody
    • Superoxide-generating NADPH oxidase heavy chain subunit antibody
    see all

References

ab180642 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180642.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up