Overview

  • Product name
    Anti-NPL4 antibody - N-terminal
    See all NPL4 primary antibodies
  • Description
    Rabbit polyclonal to NPL4 - N-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Zebrafish
  • Immunogen

    Synthetic peptide within Mouse NPL4 aa 96-145 (N terminal). The exact sequence is proprietary. (NP_001181952).
    Sequence:

    GLKAFGAPNVVEDEIDQYLSKQDGKIYRSRDPQLCRHGPLGKCVHCVPLE


    Database link: P60670

  • Positive control
    • Mouse testis lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab177445 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 68 kDa.

Target

  • Function
    The ternary complex containing UFD1L, VCP and NPLOC4 binds ubiquitinated proteins and is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome. The NPLOC4-UFD1L-VCP complex regulates spindle disassembly at the end of mitosis and is necessary for the formation of a closed nuclear envelope.
  • Tissue specificity
    Expressed at highest levels in brain, heart, skeletal muscle, kidney and fetal liver.
  • Pathway
    Protein degradation; proteasomal ubiquitin-dependent pathway.
  • Sequence similarities
    Belongs to the NPL4 family.
    Contains 1 RanBP2-type zinc finger.
  • Domain
    Binds ubiquitinated proteins via its RanBP2-type zinc finger.
  • Cellular localization
    Cytoplasm > cytosol. Endoplasmic reticulum. Nucleus. Associated with the endoplasmic reticulum and nuclear.
  • Information by UniProt
  • Database links
  • Alternative names
    • KIAA1499 antibody
    • NPL4 antibody
    • NPL4, S. cerevisiae, homolog of antibody
    • NPL4_HUMAN antibody
    • nploc4 antibody
    • nuclear protein localization 4 homolog (S. cerevisiae) antibody
    • Nuclear protein localization 4 homolog antibody
    • Nuclear protein localization protein 4 homolog antibody
    • Nuclear protein localization protein 4, S. cerevisiae, homolog of antibody
    • Protein NPL4 antibody
    see all

Images

  • Anti-NPL4 antibody - N-terminal (ab177445) at 1 µg/ml + Mouse testis lysate at 10 µg

    Predicted band size: 68 kDa

References

ab177445 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177445.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up