Anti-RFRP antibody (ab122738)
Key features and details
- Rabbit polyclonal to RFRP
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-RFRP antibody
See all RFRP primary antibodies -
Description
Rabbit polyclonal to RFRP -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human RFRP aa 105-176.
Sequence:TANLPLRSGRNMEVSLVRRVPNLPQRFGRTTTAKSVCRMLSDLCQGSMHS PCANDLFYSMTCQHQEIQNPDQ
-
Positive control
- IHC-P:Human retina tissue; WB: RT4 and U-251 MG whole cells, human liver and tonsil tissue lysates.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab122738 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
Use a concentration of 0.04 - 0.4 µg/ml.
|
|
IHC-P |
1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
Notes |
---|
WB
Use a concentration of 0.04 - 0.4 µg/ml. |
IHC-P
1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Neuropeptide RFRP-1 acts as a potent negative regulator of gonadotropin synthesis and secretion. Neuropeptides NPSF and NPVF efficiently inhibit forskolin-induced production of cAMP, but RFRP-2 shows no inhibitory activity. Neuropeptide RFRP-1 induces secretion of prolactin in rats. Neuropeptide NPVF blocks morphine-induced analgesia. -
Tissue specificity
Isoform 1 is specifically expressed in the retina. Neuropeptides RFRP-1 and NPVF are detected in the hypothalamus. -
Sequence similarities
Belongs to the FARP (FMRFamide related peptide) family. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 64111 Human
- SwissProt: Q9HCQ7 Human
- Unigene: 60473 Human
-
Alternative names
- C7orf9 antibody
- Neuropeptide NPSF antibody
- Neuropeptide NPVF antibody
see all
Images
-
Immunohistochemical analysis of human retina tissue labeling RFRP with ab122738 at a 1/1000 dilution.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
-
All lanes : Anti-RFRP antibody (ab122738) at 0.4 µg/ml
Lane 1 : RT4 (Human urinary bladder cancer cell line) whole cell lysate
Lane 2 : U-251 MG (formally U-373 MG) (Human brain glioma cell line) whole cell lysate
Lane 3 : Human plasma tissue lysate
Lane 4 : Human liver tissue lysate
Lane 5 : Human tonsil tissue lysate
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (2)
ab122738 has been referenced in 2 publications.
- Lee DA et al. Evolutionarily conserved regulation of sleep by epidermal growth factor receptor signaling. Sci Adv 5:eaax4249 (2019). PubMed: 31763451
- Zhang L et al. Green light inhibits GnRH-I expression by stimulating the melatonin-GnIH pathway in the chick brain. J Neuroendocrinol 29:N/A (2017). PubMed: 28295740