Overview

  • Product name
    Anti-NR2E1 / Tailless antibody
    See all NR2E1 / Tailless primary antibodies
  • Description
    Rabbit polyclonal to NR2E1 / Tailless
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Caenorhabditis elegans, Drosophila melanogaster, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within the N terminal amino acids 2-51 (

    SKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTYV

    ) of Human NR2E1/ Tailless (NP_003260).

  • Positive control
    • Human fetal muscle lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab86276 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 43 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Orphan receptor that binds DNA as a monomer to hormone response elements (HRE) containing an extended core motif half-site sequence 5'-AAGGTCA-3' in which the 5' flanking nucleotides participate in determining receptor specificity. May be required for brain development. May be involved in the regulation of retinal development.
  • Tissue specificity
    Brain specific. Present in all brain sections tested, highest levels in the caudate nucleus and hippocampus, weakest levels in the thalamus.
  • Sequence similarities
    Belongs to the nuclear hormone receptor family. NR2 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • hTll antibody
    • nr2e1 antibody
    • NR2E1_HUMAN antibody
    • Nuclear receptor subfamily 2 group E member 1 antibody
    • Nuclear receptor TLX antibody
    • Orphan nuclear receptor NR2E1 antibody
    • Protein tailless homolog antibody
    • Tailless homolog antibody
    • Tll antibody
    • TLX antibody
    • XTLL antibody
    see all

Anti-NR2E1 / Tailless antibody images



  • Predicted band size : 43 kDa
    Western blot analysis of Human fetal heart tissue lysate labeling NR2E1 / Tailless with ab86276 at 1.0µg/ml.
  • Anti-NR2E1 / Tailless antibody (ab86276) at 1 µg/ml (5% skim milk/ PBS buffer) + fetal muscle lysate at 10 µg with gel concentration: 12%

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 43 kDa
    Observed band size : 43 kDa
  • ab86276 staining NR2E1 / Tailless in colon tissue by Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections).
  • ab86276 staining NR2E1 / Tailless in human brain, cortex tissue by Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections).
  • ab86276 staining NR2E1 / Tailless in human placenta tissue by Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections).
  • ab86276 staining NR2E1 / Tailless in human prostate tissue by Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections).

References for Anti-NR2E1 / Tailless antibody (ab86276)

ab86276 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab86276.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up