Overview

  • Product name
    Anti-NR2E1 / Tailless antibody
    See all NR2E1 / Tailless primary antibodies
  • Description
    Rabbit polyclonal to NR2E1 / Tailless
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Caenorhabditis elegans, Drosophila melanogaster, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within the N terminal amino acids 2-51 (

    SKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTYV

    ) of Human NR2E1/ Tailless (NP_003260).

  • Positive control
    • Human fetal muscle lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab86276 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 43 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Orphan receptor that binds DNA as a monomer to hormone response elements (HRE) containing an extended core motif half-site sequence 5'-AAGGTCA-3' in which the 5' flanking nucleotides participate in determining receptor specificity. May be required for brain development. May be involved in the regulation of retinal development.
  • Tissue specificity
    Brain specific. Present in all brain sections tested, highest levels in the caudate nucleus and hippocampus, weakest levels in the thalamus.
  • Sequence similarities
    Belongs to the nuclear hormone receptor family. NR2 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • hTll antibody
    • nr2e1 antibody
    • NR2E1_HUMAN antibody
    • Nuclear receptor subfamily 2 group E member 1 antibody
    • Nuclear receptor TLX antibody
    • Orphan nuclear receptor NR2E1 antibody
    • Protein tailless homolog antibody
    • Tailless homolog antibody
    • Tll antibody
    • TLX antibody
    • XTLL antibody
    see all

Images



  • Predicted band size : 43 kDa
    Western blot analysis of Human fetal heart tissue lysate labeling NR2E1 / Tailless with ab86276 at 1.0µg/ml.
  • Anti-NR2E1 / Tailless antibody (ab86276) at 1 µg/ml (5% skim milk/ PBS buffer) + fetal muscle lysate at 10 µg with gel concentration: 12%

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 43 kDa
    Observed band size : 43 kDa
  • ab86276 staining NR2E1 / Tailless in colon tissue by Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections).
  • ab86276 staining NR2E1 / Tailless in human brain, cortex tissue by Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections).
  • ab86276 staining NR2E1 / Tailless in human placenta tissue by Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections).
  • ab86276 staining NR2E1 / Tailless in human prostate tissue by Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections).

References

ab86276 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab86276.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up