Overview

  • Product nameAnti-NRARP antibody
    See all NRARP primary antibodies
  • Description
    Rabbit polyclonal to NRARP
  • Tested applicationsSuitable for: ICC/IF, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Cow, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region of Human NRARP within internal amino acids 36-85 (

    NMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDGW

    ) (NP_001004354)

  • Positive control
    • HepG2 cell lysate This antibody gave a positive result when used in the following methanol fixed cell lines: CACO-2.

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab90859 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 5 µg/ml.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 12 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-NRARP antibody images

  • ICC/IF image of ab90859 stained CACO-2 cells. The cells were 100% methanol fixed (5 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody ab90859 at 5µg/ml overnight at +4°C. The secondary antibody (green) was DyLight® 488 goat anti- rabbit (ab96899) IgG (H+L) used at a 1/250 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

  • Anti-NRARP antibody (ab90859) at 1 µg/ml + HepG2 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 12 kDa

References for Anti-NRARP antibody (ab90859)

ab90859 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us. Because we carry over 70,000 products, it isn't feasible for us to keep small sample sizes of our products.

We are happy to reassure our customers that all of our products are covered by our Abpromise, which gu...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"