Overview

  • Product nameAnti-NRBF2 antibody
    See all NRBF2 primary antibodies
  • Description
    Rabbit polyclonal to NRBF2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Cow, Cat, Dog, Human
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 5-54 (

    EGPLNLAHQQSRRADRLLAAGKYEEAISCHRKATTYLSEAMKLTESEQAH

    ) of Mouse NRBF2 (NM_001036293).

  • Positive control
    • Mouse pancreas lysate

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab125315 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 32 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-NRBF2 antibody images

  • Anti-NRBF2 antibody (ab125315) at 1 µg/ml + Mouse pancreas lysate at 10 µg

    Predicted band size : 32 kDa

References for Anti-NRBF2 antibody (ab125315)

ab125315 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab125315.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"