Overview

  • Product nameAnti-NRBP2 antibody
    See all NRBP2 primary antibodies
  • Description
    Rabbit polyclonal to NRBP2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 179-227 (

    IQMQCNLERSEDKARWHLTLLLVLEDRLHRQLTYDLLPTDSAQDLASELV

    ) of Human NRBP2 (NP_848659).

  • Positive control
    • Placenta lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Associated products

Applications

Our Abpromise guarantee covers the use of ab94697 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 30 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionMay regulate apoptosis of neural progenitor cells during their differentiation.
  • Sequence similaritiesBelongs to the protein kinase superfamily. Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
  • DomainThe protein kinase domain is predicted to be catalytically inactive.
  • Cellular localizationCytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • BC011468 antibody
    • DKFZp434P086 antibody
    • MGC12117 antibody
    • MGC138699 antibody
    • MGC18994 antibody
    • NRBP2 antibody
    • NRBP2_HUMAN antibody
    • Nuclear receptor binding protein 2 antibody
    • Nuclear receptor-binding protein 2 antibody
    • PP9320 antibody
    • Transformation related gene 16 protein antibody
    • Transformation-related gene 16 protein antibody
    • transformation-related protein 16 antibody
    • TRG 16 antibody
    • TRG-16 antibody
    • TRG16 antibody
    see all

Anti-NRBP2 antibody images

  • Anti-NRBP2 antibody (ab94697) at 1 µg/ml + placenta lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 30 kDa

References for Anti-NRBP2 antibody (ab94697)

ab94697 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab94697.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"