Overview

  • Product name
  • Description
    Rabbit polyclonal to NRBP2
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 179-227 (

    IQMQCNLERSEDKARWHLTLLLVLEDRLHRQLTYDLLPTDSAQDLASELV

    ) of Human NRBP2 (NP_848659).

  • Positive control
    • Placenta lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab94697 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 30 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    May regulate apoptosis of neural progenitor cells during their differentiation.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
  • Domain
    The protein kinase domain is predicted to be catalytically inactive.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • BC011468 antibody
    • DKFZp434P086 antibody
    • MGC12117 antibody
    • MGC138699 antibody
    • MGC18994 antibody
    • NRBP2 antibody
    • NRBP2_HUMAN antibody
    • Nuclear receptor binding protein 2 antibody
    • Nuclear receptor-binding protein 2 antibody
    • PP9320 antibody
    • Transformation related gene 16 protein antibody
    • Transformation-related gene 16 protein antibody
    • transformation-related protein 16 antibody
    • TRG 16 antibody
    • TRG-16 antibody
    • TRG16 antibody
    see all

Images

  • Anti-NRBP2 antibody (ab94697) at 1 µg/ml + placenta lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 30 kDa

References

ab94697 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab94697.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up