
  • Product nameAnti-NRG3 antibody
    See all NRG3 primary antibodies
  • Description
    Rabbit polyclonal to NRG3
  • Tested applicationsSuitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    A synthetic peptide corresponding to a region within the internal sequence 539-588 (TSINMQLPSRETNPYFNSLEQKDLVGYSSTRASSVPIIPSVGLEETCLQ M) of Human NRG3 (NP_001010848).

  • Positive control
    • Jurkat Cell Lysate


  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • Purification notesPurified by peptide affinity chromatography method.
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Associated products


Our Abpromise guarantee covers the use of ab83704 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 4 - 8 µg/ml.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 78 kDa.Can be blocked with NRG3 peptide (ab185897). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • FunctionDirect ligand for the ERBB4 tyrosine kinase receptor. Binding results in ligand-stimulated tyrosine phosphorylation and activation of the receptor. Does not bind to the EGF receptor, ERBB2 or ERBB3 receptors. May be a survival factor for oligodendrocytes.
  • Tissue specificityHighly expressed in most regions of the brain with the exception of corpus callosum. Expressed at lower level in testis. Not detected in heart, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, ovary, small intestine, colon and peripheral blood leukocytes.
  • Sequence similaritiesBelongs to the neuregulin family.
    Contains 1 EGF-like domain.
  • Developmental stageIsoform 3 is expressed in fetal brain but not in other fetal tissues.
  • DomainThe cytoplasmic domain may be involved in the regulation of trafficking and proteolytic processing. Regulation of the proteolytic processing involves initial intracellular domain dimerization.
    ERBB receptor binding is elicited entirely by the EGF-like domain.
  • Post-translational
    Proteolytic cleavage close to the plasma membrane on the external face leads to the release of the soluble growth factor form.
    Extensive glycosylation precedes the proteolytic cleavage (By similarity). Isoform 3 is glycosylated.
  • Cellular localizationSecreted; Cell membrane. Does not seem to be active and Cell membrane. Isoform 3 is also proteolytically released as a soluble form.
  • Information by UniProt
  • Database links
  • Alternative names
    • HRG3 antibody
    • Neuregulin 3 antibody
    • Neuregulin 3 like polypeptide antibody
    • Neuregulin-3 antibody
    • Neuregulin3 antibody
    • NRG-3 antibody
    • Nrg3 antibody
    • NRG3_HUMAN antibody
    • Pro neuregulin 3 antibody
    • pro NRG3 antibody
    • Pro-NRG3 antibody
    see all

Anti-NRG3 antibody images

  • Anti-NRG3 antibody (ab83704) at 1 µg/ml (diluted in 5% skim milk / PBS buffer) + Jurkat Cell Lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 78 kDa
    Observed band size : 78 kDa
    Gel concentration: 12%
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human brain, cortex tissue labelling NRG3 with ab83704 at 4-8µg/ml.

References for Anti-NRG3 antibody (ab83704)

ab83704 has not yet been referenced specifically in any publications.

Product Wall

The NRG3 peptide has been added as item ab185897.

Please let me know if you have any questions, for instance regarding how to block the antibody with the peptide. In general, incubating equal amounts by weight of concentrated antibody and...

Read More