Overview

  • Product name
  • Description
    Rabbit polyclonal to NRG4
  • Specificity
    ab192475 detects endogenous levels of NRG4 protein.
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human NRG4 aa 1-115.
    Sequence:

    MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFL PGSSIQTKSN LFEAFVALAVLVTLIIGAFYFLCRKGHFQRASSVQYDI NLVETSSTSAHHSHEQH


    Database link: Q8WWG1

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.1% Sodium azide
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab192475 was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen and the purity is > 95% (by SDS-PAGE).
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab192475 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 13 kDa.
IHC-P 1/50 - 1/200.

Target

  • Function
    Low affinity ligand for the ERBB4 tyrosine kinase receptor. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. Does not bind to the ERBB1, ERBB2 and ERBB3 receptors.
  • Sequence similarities
    Belongs to the neuregulin family.
    Contains 1 EGF-like domain.
  • Domain
    The cytoplasmic domain may be involved in the regulation of trafficking and proteolytic processing. Regulation of the proteolytic processing involves initial intracellular domain dimerization.
    ERBB receptor binding is elicited entirely by the EGF-like domain.
  • Post-translational
    modifications
    Proteolytic cleavage close to the plasma membrane on the external face leads to the release of the soluble growth factor form.
    Extensive glycosylation precedes the proteolytic cleavage.
  • Cellular localization
    Secreted and Cell membrane. Does not seem to be active.
  • Information by UniProt
  • Database links
  • Alternative names
    • DKFZp779N0541 antibody
    • DKFZp779N1944 antibody
    • Heregulin 4 antibody
    • HRG4 antibody
    • Neuregulin 4 antibody
    • Neuregulin-4 antibody
    • NRG-4 antibody
    • NRG4 antibody
    • NRG4_HUMAN antibody
    • pro-neuregulin-4, membrane-bound isoform antibody
    • Pro-NRG4 antibody
    see all

References

ab192475 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192475.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up