Overview

  • Product name
  • Description
    Rabbit polyclonal to NSMase2
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human NSMase2 aa 1-655. (NP_061137.1).
    Sequence:

    MVLYTTPFPNSCLSALHCVSWALIFPCYWLVDRLAASFIPTTYEKRQRAD DPCCLQLLCTALFTPIYLALLVASLPFAFLGFLFWSPLQSARRPYIYSRL EDKGLAGGAALLSEWKGTGPGKSFCFATANVCLLPDSLARVNNLFNTQAR AKEIGQRIRNGAARPQIKIYIDSPTNTSISAASFSSLVSPQGGDGVARAV PGSIKRTASVEYKGDGGRHPGDEAANGPASGDPVDSSSPEDACIVRIGGE EGGRPPEADDPVPGGQARNGAGGGPRGQTPNHNQQDGDSGSLGSPSASRE SLVKGRAGPDTSASGEPGANSKLLYKASVVKKAAARRRRHPDEAFDHEVS AFFPANLDFLCLQEVFDKRAATKLKEQLHGYFEYILYDVGVYGCQGCCSF KCLNSGLLFASRYPIMDVAYHCYPNKCNDDALASKGALFLKVQVGSTPQD QRIVGYIACTHLHAPQEDSAIRCGQLDLLQDWLADFRKSTSSSSAANPEE LVAFDVVCGDFNFDNCSSDDKLEQQHSLFTHYRDPCRLGPGEEKPWAIGT LLDTNGLYDEDVCTPDNLQKVLESEEGRREYLAFPTSKSSGQKGRKELLK GNGRRIDYMLHAEEGLCPDWKAEVEEFSFITQLSGLTDHLPVAMRLMVSS GEEEA


    Database link: Q9NY59

  • Positive control
    • NSMase2 transfected 293T cell line lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab172793 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 71 kDa.

Target

  • Function
    Catalyzes the hydrolysis of sphingomyelin to form ceramide and phosphocholine. Ceramide mediates numerous cellular functions, such as apoptosis and growth arrest, and is capable of regulating these 2 cellular events independently. Also hydrolyzes sphingosylphosphocholine. Regulates the cell cycle by acting as a growth suppressor in confluent cells. Probably acts as a regulator of postnatal development and participates in bone and dentin mineralization.
  • Tissue specificity
    Predominantly expressed in brain.
  • Sequence similarities
    Belongs to the neutral sphingomyelinase family.
  • Developmental stage
    Up-regulated during G0/G1 phases.
  • Cellular localization
    Golgi apparatus membrane. Cell membrane. May localize to detergent-resistant subdomains of Golgi membranes of hypothalamic neurosecretory neurons. According to PubMed:15051724, it localizes to plasma membrane in confluent contact-inhibited cells.
  • Information by UniProt
  • Database links
  • Alternative names
    • Cca1 antibody
    • Confluent 3Y1 cell-associated protein 1 antibody
    • Neutral sphingomyelinase 2 antibody
    • Neutral sphingomyelinase II antibody
    • NSMA2_HUMAN antibody
    • nSMase-2 antibody
    • nSMase2 antibody
    • SMPD3 antibody
    • Sphingomyelin phosphodiesterase 3 antibody
    • sphingomyelin phosphodiesterase 3, neutral membrane (neutral sphingomyelinase II) antibody
    see all

Images

  • All lanes : Anti-NSMase2 antibody (ab172793) at 1 µg/ml

    Lane 1 : NSMase2 transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Lysates/proteins at 15 µl per lane.


    Predicted band size : 71 kDa

References

ab172793 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172793.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up