Overview

  • Product name
    Anti-Nucleoporin p62 antibody [2A]
    See all Nucleoporin p62 primary antibodies
  • Description
    Rat monoclonal [2A] to Nucleoporin p62
  • Host species
    Rat
  • Tested applications
    Suitable for: WB, IP, ICC/IFmore details
  • Species reactivity
    Reacts with: Human, African green monkey
    Does not react with: Mouse
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human Nucleoporin p62 aa 1-300. (N terminal proprietary tag).
    Sequence:

    MSGFNFGGTGAPTGGFTFGTAKTATTTPATGFSFSTSGTGGFNFGAPFQP ATSTPSTGLFSLATQTPATQTTGFTFGTATLASGGTGFSLGIGASKLNLS NTAATPAMANPSGFGLGSSNLTNAISSTVTSSQGTAPTGFVFGPSTTSVA PATTSGGFSFTGGSTAQPSGFNIGSAGNSAQPTAPATLPFTPATPAATTA GATQPAAPTPTATITSTGPSLFASIATAPTSSATTGLSLCTPVTTAGAPT AGTQGFSLKAPGAASGTSTTTSTAATATATTTSSSSTTGFALNLKPLAPA


    Database link: P37198

  • Epitope
    aa 1-179 (FG-repeat region)
  • Positive control
    • HeLa cells and Cos cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab188413 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Detects a band of approximately 60 kDa (predicted molecular weight: 53 kDa).
IP Use at an assay dependent concentration.
ICC/IF 1/400.

Target

  • Relevance
    The nuclear pore complex is a structure that extends across the nuclear envelope and regulates the flow of macromolecules between the cytoplasm and the nucleus. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. Nup 62 is localized to the nuclear pore central plug. This protein associates with the importin alpha/beta complex which is involved in the import of proteins containing nuclear localization signals. There are multiple transcript variants of this gene, however, they encode a single protein isoform. This protein undergoes post-translational modifications. It contains about 10 N-acetylglucosamine side chain sites.
  • Cellular localization
    Nucleus; nuclear pore complex. Cytoplasm; cytoskeleton; spindle pole. Note: Central region of the nuclear pore, within the transporter. During mitotic cell division, it associates with the poles of the mitotic spindle.
  • Database links
  • Alternative names
    • 62 kDa nucleoporin antibody
    • DKFZp547L134 antibody
    • FLJ20822 antibody
    • FLJ43869 antibody
    • IBSN antibody
    • MGC841 antibody
    • Nuclear pore glycoprotein p62 antibody
    • nucleoporin 62kDa antibody
    • Nucleoporin Nup62 antibody
    • nucleoporin p62 antibody
    • nucleoporin p62KD antibody
    • NUP62 antibody
    • NUP62 protein antibody
    • p62 antibody
    • SNDI antibody
    see all

Images

  • Anti-Nucleoporin p62 antibody [2A] (ab188413) at 1/500 dilution + HeLa nuclear membrane lysate

    Secondary
    Alkaline phosphatase-conjugated anti-rat IgG

    Predicted band size: 53 kDa
    Observed band size: 60 kDa (why is the actual band size different from the predicted?)

  • Immunofluorescent analysis of HeLa cells labeling Nucleoporin p62 with ab188413 at 1/400 dilution, followed by Alexa Fluor®488-conjugated goat anti-rat IgG secondary antibody at 1/500 dilution. HeLa cells were fixed with 3.7% formaldehyde and
    permeabilized with 0.5% Triton X-100.

  • Immunofluorescent analysis of HeLa cells, labeling Nucleoporin p62 with ab188413 at 1/400 dilution, followed by Alexa Fluor®488-conjugated goat anti-rat IgG secondary antibody at 1/500 dilution. HeLa cells were fixed with 3.7% formaldehyde and
    permeabilized with 0.5% Triton X-100.

References

This product has been referenced in:
  • Linder MI  et al. Mitotic Disassembly of Nuclear Pore Complexes Involves CDK1- and PLK1-Mediated Phosphorylation of Key Interconnecting Nucleoporins. Dev Cell 43:141-156.e7 (2017). Read more (PubMed: 29065306) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188413.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up