Anti-Nucleoside Diphosphate Kinase 7 antibody - N-terminal (ab174800)

Overview

  • Product name
    Anti-Nucleoside Diphosphate Kinase 7 antibody - N-terminal
    See all Nucleoside Diphosphate Kinase 7 primary antibodies
  • Description
    Rabbit polyclonal to Nucleoside Diphosphate Kinase 7 - N-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human
  • Immunogen

    Synthetic peptide within Mouse Nucleoside Diphosphate Kinase 7 aa 88-137 (N terminal). The exact sequence is proprietary. NP_612187.2.
    Sequence:

    FSRQLVLIDYGDQYTARQLGSRKEKTLALIKPDAVSKAGEIIEMINKSGF


    Database link: Q9QXL8

  • Positive control
    • Mouse liver tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab174800 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 44 kDa.

Target

Images

  • Anti-Nucleoside Diphosphate Kinase 7 antibody - N-terminal (ab174800) at 1 µg/ml + Mouse liver lysate at 10 µg

    Predicted band size: 44 kDa

References

ab174800 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174800.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up