Anti-Nucleostemin antibody (ab14293)

Overview

  • Product nameAnti-Nucleostemin antibody
    See all Nucleostemin primary antibodies
  • Description
    Chicken polyclonal to Nucleostemin
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide corresponding to Human Nucleostemin aa 1-280.
    Sequence:

    MKRPKLKKASKRMTCHKRYKIQKKVREHHRKLRKEAKKQGHKKPRKDPGV PNSAPFKEAL LREAELRKQRLEELKQQQKLDRQKELEKKRKLETNPDI KPSNVEPMEKEFGLCKTENKAK SGKQNSKKLYCQELKKVIEASDVVLE VLDARDPLGCRCPQVEEAIVQSGQKKLVLILNKS DLVPKENLESWLNY LKKELPTVVFRASTKPKDKGKITKRVKAKKNAAPFRSEVCFGKEGL WK LLGGFQETCSKAIRVGVIGFPNVGKSSIINSLKQEQMC

  • General notesDuring shipment, small volumes of product will occasionally become entrapped in the seal of the product vial. For products with volumes of 200 µL or less, we recommend gently tapping the vial on a hard surface or briefly centrifuging the vial in a tabletop centrifuge to dislodge any liquid in the container's cap.

Properties

Applications

Our Abpromise guarantee covers the use of ab14293 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/2000. Predicted molecular weight: 66 kDa.

Target

  • FunctionMay be required to maintain the proliferative capacity of stem cells and may play an important role in tumorigenesis.
  • Tissue specificityIncreased levels in lung tissue in cancer patients.
  • Sequence similaritiesBelongs to the MMR1/HSR1 GTP-binding protein family.
    Contains 1 G (guanine nucleotide-binding) domain.
  • DomainThe basic domain (B) allows nucleolar localization in the absence of GTP. The intermediate domain (I) inhibits nucleolar localization by the B domain and is required for exit from the nucleolus. Exit from the nucleolus to the nucleoplasm requires both the I and the acidic (A) domains, and may be triggered by GTP hydrolysis.
    In contrast to other GTP-binding proteins, this family is characterized by a circular permutation of the GTPase motifs described by a G4-G1-G3 pattern.
  • Cellular localizationNucleus. Nucleus > nucleolus. Shuttles between the nucleus and nucleolus.
  • Information by UniProt
  • Database links
  • Alternative names
    • C77032 antibody
    • E2 induced gene 3 protein antibody
    • E2-induced gene 3 protein antibody
    • E2IG3 antibody
    • Estradiol induced nucleotide binding protein antibody
    • GNL3 antibody
    • GNL3_HUMAN antibody
    • Guanine nucleotide binding protein like 3 (nucleolar) antibody
    • Guanine nucleotide binding protein like 3 antibody
    • Guanine nucleotide-binding protein-like 3 antibody
    • MGC800 antibody
    • NNP47 antibody
    • Novel nucleolar protein 47 antibody
    • NS antibody
    • Nucleolar GTP binding protein 3 antibody
    • Nucleolar GTP-binding protein 3 antibody
    • Nucleostemin antibody
    • Putative nucleotide binding protein estradiol induced antibody
    see all

Anti-Nucleostemin antibody images



  • Predicted band size : 66 kDa


    E coli-derived fusion protein as test antigen. Affi-anti- RGS6 IgY dilution: 1:2000, Goat anti-IgY-HRP dilution: 1:1000. Colorimetric method for signal development. Arrow points to E2IG3 fusion protein.

References for Anti-Nucleostemin antibody (ab14293)

ab14293 has not yet been referenced specifically in any publications.

Product Wall

Abcam has not validated the combination of species/application used in this Abreview.
Application Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample Rat Tissue sections (Adult rat brain)
Specification Adult rat brain
Fixative Formaldehyde
Antigen retrieval step Heat mediated - Buffer/Enzyme Used: Citric acid pH6
Permeabilization No
Blocking step BSA as blocking agent for 10 minute(s) · Concentration: 1% · Temperature: rt°C
Username

Mr. Carl Hobbs

Verified customer

Submitted May 14 2009

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"