Overview

  • Product name
    Anti-NUDT15 antibody
  • Description
    Rabbit polyclonal to NUDT15
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Saccharomyces cerevisiae
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 33-82 (

    RKGSFGAGSFQLPGGHLEFGETWEECAQRETWEEAGLHLKNVCFASVVNS

    ) of Mouse NUDT15 (NP_766115).

  • Positive control
    • Mouse small intestine lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Constituents: 97% PBS, 2% Sucrose
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab122958 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 19 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Mediates the hydrolysis of some nucleoside diphosphate derivatives. Can degrade 8-oxo-dGTP in vitro, suggesting that it may remove an oxidatively damaged form of guanine (7,8-dihydro-8-oxoguanine) from DNA and the nucleotide pool, thereby preventing misincorporation of 8-oxo-dGTP into DNA thus preventing A:T to C:G transversions. Its substrate specificity in vivo however remains unclear (By similarity). May have a role in DNA synthesis and cell cycle progression throught the interaction with PCNA.
  • Sequence similarities
    Belongs to the Nudix hydrolase family.
    Contains 1 nudix hydrolase domain.
  • Information by UniProt
  • Database links
  • Alternative names
    • 8-dihydro-8-oxoguanine triphosphatase NUDT15 antibody
    • 8-oxo-dGTPase NUDT15 antibody
    • A730068G11Rik antibody
    • EC 3.1.6.- antibody
    • FLJ10956 antibody
    • MGC104352 antibody
    • MTH2 antibody
    • MutT homolog 2 antibody
    • Nucleoside diphosphate-linked moiety X motif 15 antibody
    • NUD15_HUMAN antibody
    • Nudix (nucleoside diphosphate linked moiety X)-type motif antibody
    • Nudix motif 15 antibody
    • NUDT15 antibody
    • OTTHUMP00000018389 antibody
    • Probable 7 antibody
    • Probable 7,8-dihydro-8-oxoguanine triphosphatase NUDT15 antibody
    • RP11-90M2.1 antibody
    see all

Images

  • Anti-NUDT15 antibody (ab122958) at 1 µg/ml + Mouse small intestine lysate at 10 µg

    Predicted band size : 19 kDa

References

ab122958 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab122958.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up