Overview

  • Product nameAnti-NUDT15 antibody
  • Description
    Rabbit polyclonal to NUDT15
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Saccharomyces cerevisiae
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 33-82 (

    RKGSFGAGSFQLPGGHLEFGETWEECAQRETWEEAGLHLKNVCFASVVNS

    ) of Mouse NUDT15 (NP_766115).

  • Positive control
    • Mouse small intestine lysate.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferConstituents: 97% PBS, 2% Sucrose
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab122958 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 19 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionMediates the hydrolysis of some nucleoside diphosphate derivatives. Can degrade 8-oxo-dGTP in vitro, suggesting that it may remove an oxidatively damaged form of guanine (7,8-dihydro-8-oxoguanine) from DNA and the nucleotide pool, thereby preventing misincorporation of 8-oxo-dGTP into DNA thus preventing A:T to C:G transversions. Its substrate specificity in vivo however remains unclear (By similarity). May have a role in DNA synthesis and cell cycle progression throught the interaction with PCNA.
  • Sequence similaritiesBelongs to the Nudix hydrolase family.
    Contains 1 nudix hydrolase domain.
  • Information by UniProt
  • Database links
  • Alternative names
    • 8-dihydro-8-oxoguanine triphosphatase NUDT15 antibody
    • 8-oxo-dGTPase NUDT15 antibody
    • A730068G11Rik antibody
    • EC 3.1.6.- antibody
    • FLJ10956 antibody
    • MGC104352 antibody
    • MTH2 antibody
    • MutT homolog 2 antibody
    • Nucleoside diphosphate-linked moiety X motif 15 antibody
    • NUD15_HUMAN antibody
    • Nudix (nucleoside diphosphate linked moiety X)-type motif antibody
    • Nudix motif 15 antibody
    • NUDT15 antibody
    • OTTHUMP00000018389 antibody
    • Probable 7 antibody
    • Probable 7,8-dihydro-8-oxoguanine triphosphatase NUDT15 antibody
    • RP11-90M2.1 antibody
    see all

Anti-NUDT15 antibody images

  • Anti-NUDT15 antibody (ab122958) at 1 µg/ml + Mouse small intestine lysate at 10 ��g

    Predicted band size : 19 kDa

References for Anti-NUDT15 antibody (ab122958)

ab122958 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab122958.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"