Overview

  • Product name
    Anti-Nuf2 antibody - C-terminal
    See all Nuf2 primary antibodies
  • Description
    Rabbit polyclonal to Nuf2 - C-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Pig, Chimpanzee, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human Nuf2 aa 414-464 (C terminal). The exact sequence is proprietary. (NP_663735.2)
    Sequence:

    REKLKSQEIFLNLKTALEKYHDGIEKAAEDSYAKIDEKTAELKRKMFKMS T


    Database link: Q9BZD4

  • Positive control
    • HeLa, 293T, Jurkat, and NIH3T3 whole cell lysates.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab187682 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 54 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

  • Function
    Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity. Required for kinetochore integrity and the organization of stable microtubule binding sites in the outer plate of the kinetochore.
  • Sequence similarities
    Belongs to the NUF2 family.
  • Post-translational
    modifications
    Can be phosphorylated by AURKA and AURKB.
  • Cellular localization
    Nucleus. Chromosome > centromere > kinetochore. Localizes to kinetochores from late prophase to anaphase. Localizes specifically to the outer plate of the kinetochore.
  • Information by UniProt
  • Database links
  • Alternative names
    • Cancer/testis antigen 106 antibody
    • CDCA 1 antibody
    • CDCA1 antibody
    • Cell division cycle associated 1 antibody
    • Cell division cycle associated protein 1 antibody
    • Cell division cycle-associated protein 1 antibody
    • CT106 antibody
    • hNuf 2 antibody
    • hNuf2 antibody
    • hNuf2R antibody
    • hsNuf2 antibody
    • Kinetochore protein Nuf2 antibody
    • Nuf 2 antibody
    • NUF2 antibody
    • NUF2 NDC80 kinetochore complex component antibody
    • NUF2 NDC80 kinetochore complex component homolog antibody
    • NUF2, S. cerevisiae, homolog of antibody
    • NUF2_HUMAN antibody
    • NUF2R antibody
    see all

Images

  • All lanes : Anti-Nuf2 antibody - C-terminal (ab187682) at 0.4 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate
    Lane 4 : TCMK-1, whole cell lysate
    Lane 5 : NIH3T3 whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 54 kDa


    Exposure time: 30 seconds
  • Immunoprecipitation. ab187682 at 1 µg/ml staining Nuf2 in HeLa whole cell lysate immunoprecipitated using ab187682 at 6 µg/mg lysate (1 mg/IP; 20% of IP loaded/lane).

References

ab187682 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187682.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up