Overview

  • Product name
  • Description
    Rabbit polyclonal to NUPL1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Rat
    Predicted to work with: Mouse, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human
  • Immunogen

    Synthetic peptide within Rat NUPL1 aa 203-252 (internal sequence). The exact sequence is proprietary. NP_620791
    Sequence:

    GGIDFSTSSDKKSDKTGTRPEDSKALKDENLPPVICQDVENLQKFVKEQK


    Database link: P70581

  • Positive control
    • Rat thymus lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab177810 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 59 kDa.

Target

  • Relevance
    NUPL1 is a member of the nucleoporin family. It is a component of the nuclear pore complex, a complex required for trafficking across the nuclear membrane.
  • Cellular localization
    Nucleus, nuclear pore complex. Nucleus membrane; Peripheral membrane protein; Cytoplasmic side. Nucleus membrane; Peripheral membrane protein; Nucleoplasmic side. Note: Biased towards cytoplasmic side. Central region of the nuclear pore complex, within the transporter.
  • Database links
  • Alternative names
    • KIAA0410 antibody
    • Nucleoporin like 1 antibody
    • Nucleoporin p58/p45 antibody
    • NUPL 1 antibody
    • OTTHUMP00000018146 antibody
    • OTTHUMP00000042323 antibody
    • PRO2463 antibody
    see all

Images

  • Anti-NUPL1 antibody (ab177810) at 1 µg/ml + Rat thymus lysate at 10 µg

    Predicted band size: 59 kDa

References

ab177810 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177810.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up