Overview

  • Product name
  • Description
    Rabbit polyclonal to NUT
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    antigen sequence: TCPLNVHSYDPQGEGRVDPDLSKPKNLAPLQESQESYTTGTPKATSSHQG LGSTLPRRGT RNAIVPRETSVSKTHRSA, corresponding to amino acids 920-997 of Human NUT (Q86Y26).

  • Positive control
    • Human testis tissue

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab122649 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Tissue specificity
    Specifically expressed in testis.
  • Involvement in disease
    Note=A chromosomal aberration involving NUT is found in a rare, aggressive, and lethal carcinoma arising in midline organs of young people. Translocation t(15;19)(q14;p13) with BRD4 which produces a BRD4-NUT fusion protein.
    Note=A chromosomal aberration involving NUT is found in a rare, aggressive, and lethal carcinoma arising in midline organs of young people. Translocation t(15;9)(q14;q34) with BRD3 which produces a BRD3-NUT fusion protein.
  • Sequence similarities
    Belongs to the FAM22 family.
  • Post-translational
    modifications
    Phosphorylation on Ser-1026, Ser-1029 or Ser-1031 is important for cytoplasmic export.
  • Cellular localization
    Cytoplasm. Nucleus. Shuttles between nucleus and cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • C15orf55 antibody
    • Chromosome 15 open reading frame 55 antibody
    • DKFZp434O192 antibody
    • MGC138683 antibody
    • MGC138684 antibody
    • Nuclear protein in testis antibody
    • NUT antibody
    • NUT_HUMAN antibody
    • Protein NUT antibody
    see all

Images

  • ab122649, at 1/500, staining NUT in paraffin embedded Human testis tissue by Immunohistochemistry.

References

ab122649 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab122649.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up