Overview

  • Product nameAnti-NUT antibody
    See all NUT primary antibodies
  • Description
    Rabbit polyclonal to NUT
  • Tested applicationsSuitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    antigen sequence: TCPLNVHSYDPQGEGRVDPDLSKPKNLAPLQESQESYTTGTPKATSSHQG LGSTLPRRGT RNAIVPRETSVSKTHRSA, corresponding to amino acids 920-997 of Human NUT (Q86Y26).

  • Positive control
    • Human testis tissue

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferpH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Associated products

Applications

Our Abpromise guarantee covers the use of ab122649 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Tissue specificitySpecifically expressed in testis.
  • Involvement in diseaseNote=A chromosomal aberration involving NUT is found in a rare, aggressive, and lethal carcinoma arising in midline organs of young people. Translocation t(15;19)(q14;p13) with BRD4 which produces a BRD4-NUT fusion protein.
    Note=A chromosomal aberration involving NUT is found in a rare, aggressive, and lethal carcinoma arising in midline organs of young people. Translocation t(15;9)(q14;q34) with BRD3 which produces a BRD3-NUT fusion protein.
  • Sequence similaritiesBelongs to the FAM22 family.
  • Post-translational
    modifications
    Phosphorylation on Ser-1026, Ser-1029 or Ser-1031 is important for cytoplasmic export.
  • Cellular localizationCytoplasm. Nucleus. Shuttles between nucleus and cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • C15orf55 antibody
    • Chromosome 15 open reading frame 55 antibody
    • DKFZp434O192 antibody
    • MGC138683 antibody
    • MGC138684 antibody
    • Nuclear protein in testis antibody
    • NUT antibody
    • NUT_HUMAN antibody
    • Protein NUT antibody
    see all

Anti-NUT antibody images

  • ab122649, at 1/500, staining NUT in paraffin embedded Human testis tissue by Immunohistochemistry.

References for Anti-NUT antibody (ab122649)

ab122649 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab122649.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"