Overview

  • Product name
  • Description
    Rabbit polyclonal to NYS48
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Chimpanzee, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human NYS48 aa 1-410.
    Sequence:

    MADSSGRGAGKPATGPTNSSSAKKKDKRVQGGRVIESRYLQYEKKTTQKA PAGDGSQTRGKMSEGGRKSSLLQKSKADSSGVGKGDLQSTLLEGHGTAPP DLDLSAINDKSIVKKTPQLAKTISKKPESTSFSAPRKKSPDLSEAMEMME SQTLLLTLLSVKMENNLAEFERRAEKNLLIMCKEKEKLQKKAHELKRRLL LSQRKRELADVLDAQIEMLSPFEAVATRFKEQYRTFATALDTTRHELPVR SIHLEGDGQQLLDALQHELVTTQRLLGELDVGDSEENVQVLDLLSELKDV TAKKDLELRRSFAQVLELSAEASKEAALANQEVWEETQGMAPPSRWYFNQ DSACRESGGAPKNTPLSEDDNPGASSAPAQATFISPSEDFSSSSQAEVPP SLSRSGRDLS


    Database link: Q9BT25

  • Positive control
    • S phase HeLa cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.01% Sodium azide
    Constituents: 0.27% Potassium phosphate, 0.88% Sodium chloride
  • Purity
    Whole antiserum
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab181633 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/10000. Predicted molecular weight: 45 kDa.

Target

  • Information by UniProt
  • Database links
  • Alternative names
    • DGT4 antibody
    • HAUS augmin like complex subunit 8 antibody
    • HAUS augmin-like complex subunit 8 antibody
    • HAUS8 antibody
    • HAUS8_HUMAN antibody
    • Hec1 interacting and centrosome associated 1 antibody
    • HEC1/NDC80 interacting centrosome associated protein 1 antibody
    • HEC1/NDC80-interacting centrosome-associated protein 1 antibody
    • HICE 1 antibody
    • HICE1 antibody
    • MGC20533 antibody
    • NY SAR 48 antibody
    • NY-SAR-48 antibody
    • Sarcoma antigen NY SAR 48 antibody
    • Sarcoma antigen NY-SAR-48 antibody
    see all

Images

  • All lanes : Anti-NYS48 antibody (ab181633) at 1/10000 dilution

    Lane 1 : sh-Luciferase lentivirus infected HeLa lysate (control)
    Lane 2 : sh-NYS48 RNAi-treated lentivirus infected HeLa lysate

    Developed using the ECL technique.

    Predicted band size: 45 kDa

References

ab181633 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181633.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up