Overview
- Product nameAnti-OAS2 antibodySee all OAS2 primary antibodies ...
- DescriptionRabbit polyclonal to OAS2
- Tested applicationsWB more details
- Species reactivityReacts with: Human
Predicted to work with: Rat, Cow, Dog, Pig, Chimpanzee - Immunogen
Synthetic peptide corresponding to a region from N terminal amino acids 36-85 (EMVNTICDVLQEPEQFPLVQGVAIGGSYGRKTVLRGNSD GTLVLFFSDLK) of Human OAS2 (NP_002526).
- Positive controlSH SYSY cell lysate
Properties
- FormLiquid
- Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
- Storage bufferPreservative: None
Constituents: 2% Sucrose, PBS -
Concentration information loading... - PurityImmunogen affinity purified
- Clonality Polyclonal
- IsotypeIgG
- Research Areas
Applications
Our Abpromise guarantee covers the use of ab90045 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Notes |
|---|---|
| WB | WB: Use a concentration of 1 µg/ml. Predicted molecular weight: 79 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T. |
Target
- FunctionMay play a role in mediating resistance to virus infection, control of cell growth, differentiation, and apoptosis.
- Sequence similaritiesBelongs to the 2-5A synthase family.
- Cellular localizationMitochondrion. Nucleus. Microsome. Endoplasmic reticulum. Associated with different subcellular fractions such as mitochondrial, nuclear, and rough/smooth microsomal fractions.
-
Database links
- Entrez Gene: 4939 Human
- Entrez Gene: 363938 Rat
- Omim: 603350 Human
- SwissProt: P29728 Human
- SwissProt: Q5MYU0 Rat
- Unigene: 414332 Human
Target information above from: UniProt accession
P29728
The UniProt Consortium
The Universal Protein Resource (UniProt) in 2010
Nucleic Acids Res. 38:D142-D148 (2010)
.
-
Alternative names
- (2-5'')oligo(A) synthase 2 antibody(2-5')oligo(A) synthetase 2 antibody2''-5''-oligoadenylate synthase 2 antibody
- 2'-5'-oligoadenylate synthetase 2 antibody2'-5'-oligoadenylate synthetase 2, 69/71kDa antibody2-5A synthase 2 antibody2-5A synthetase 2 antibodyMGC78578 antibodyOAS2 antibodyOAS2_HUMAN antibodyp69 OAS / p71 OAS antibodyp69OAS / p71OAS antibody
see all
Anti-OAS2 antibody images
-
Anti-OAS2 antibody (ab90045) at 1 µg/ml (5% skim milk / PBS buffer) + SH SYSY cell lysate at 10 µg
Secondary
HRP conjugated anti-Rabbit IgG at 1/50000 dilution
Predicted band size : 79 kDa
References for Anti-OAS2 antibody (ab90045)
ab90045 has not yet been referenced specifically in any publications.


