Overview

  • Product nameAnti-OAS2 antibodySee all OAS2 primary antibodies ...
  • Description
    Rabbit polyclonal to OAS2
  • Tested applicationsWB more details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat, Rabbit, Horse, Cow, Cat, Dog, Pig, Chimpanzee
  • Immunogen

    Synthetic peptide corresponding to a region from N terminal amino acids 36-85 (EMVNTICDVLQEPEQFPLVQGVAIGGSYGRKTVLRGNSDGTLVLFFSDL K) of Human OAS2 (NP_002526).

  • Positive control
    • SH SYSY cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab90045 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 79 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionMay play a role in mediating resistance to virus infection, control of cell growth, differentiation, and apoptosis.
  • Sequence similaritiesBelongs to the 2-5A synthase family.
  • Cellular localizationMitochondrion. Nucleus. Microsome. Endoplasmic reticulum. Associated with different subcellular fractions such as mitochondrial, nuclear, and rough/smooth microsomal fractions.
  • Target information above from: UniProt accession P29728 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links
  • Alternative names
    • (2-5'')oligo(A) synthase 2 antibody
    • (2-5')oligo(A) synthetase 2 antibody
    • 2''-5''-oligoadenylate synthase 2 antibody
    • 2'-5'-oligoadenylate synthetase 2 antibody
    • 2'-5'-oligoadenylate synthetase 2, 69/71kDa antibody
    • 2-5A synthase 2 antibody
    • 2-5A synthetase 2 antibody
    • MGC78578 antibody
    • OAS2 antibody
    • OAS2_HUMAN antibody
    • p69 OAS / p71 OAS antibody
    • p69OAS / p71OAS antibody
    see all

Anti-OAS2 antibody images

  • Anti-OAS2 antibody (ab90045) at 1 µg/ml (5% skim milk / PBS buffer) + SH SYSY cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 79 kDa

References for Anti-OAS2 antibody (ab90045)

ab90045 has not yet been referenced specifically in any publications.

Product Wall

Application Western blot
Sample Human Cell lysate - whole cell (Fibroblasts)
Loading amount 35 µg
Specification Fibroblasts
Gel Running Conditions Reduced Denaturing (4-12% Bis-Tris Gel, MOPS Buffer)
Blocking step Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: RT°C
Username

Mr. Daniel Meier

Verified customer

Submitted Dec 15 2010

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"