Overview

  • Product name
  • Description
    Mouse polyclonal to Oct-1
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Chicken, Cow, Dog, Pig
  • Immunogen

    Full length protein corresponding to Human Oct-1 aa 1-743.
    Sequence:

    MNNPSETSKPSMESGDGNTGTQTNGLDFQKQPVPVGGAISTAQAQAFLGH LHQVQLAGTSLQAAAQSLNVQSKSNEESGDSQQPSQPSQQPSVQAAIPQT QLMLAGGQITGLTLTPAQQQLLLQQAQAQAQLLAAAVQQHSASQQHSAAG ATISASAATPMTQIPLSQPIQIAQDLQQLQQLQQQNLNLQQFVLVHPTTN LQPAQFIISQTPQGQQGLLQAQNLLTQLPQQSQANLLQSQPSITLTSQPA TPTRTIAATPIQTLPQSQSTPKRIDTPSLEEPSDLEELEQFAKTFKQRRI KLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWL NDAENLSSDSSLSSPSALNSPGIEGLSRRRKKRTSIETNIRVALEKSFLE NQKPTSEEITMIADQLNMEKEVIRVWFCNRRQKEKRINPPSSGGTSSSPI KAIFPSPTSLVATTPSLVTSSAATTLTVSPVLPLTSAAVTNLSVTGTSDT TSNNTATVISTAPPASSAVTSPSLSPSPSASASTSEASSASETSTTQTTS TPLSSPLGTSQVMVTASGLQTAAAAALQGAAQLPANASLAAMAAAAGLNP SLMAPSQFAAGGALLSLNPGTLSGALSPALMSNSTLATIQALASGGSLPI TSLDATGNLVFANAGGAPNIVTAPLFLNPQNLSLLTSNPVSLVSAAAASA GNSAPVASLHATSTSAESIQNSLFTVASASGAASTTTTASKAQ


    Database link: P14859

  • Positive control
    • HeLa cells; Oct-1 transfected 293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab167483 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 76 kDa.
ICC/IF Use a concentration of 10 µg/ml.

Target

  • Function
    Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3') and activates the promoters of the genes for some small nuclear RNAs (snRNA) and of genes such as those for histone H2B and immunoglobulins. Modulates transcription transactivation by NR3C1, AR and PGR (By similarity). In case of human herpes simplex virus (HSV) infection, POU2F1 forms a multiprotein-DNA complex with the viral transactivator protein VP16 and HCFC1 thereby enabling the transcription of the viral immediate early genes.
  • Tissue specificity
    Ubiquitous. Isoform 2 is lymphocyte-specific.
  • Sequence similarities
    Belongs to the POU transcription factor family. Class-2 subfamily.
    Contains 1 homeobox DNA-binding domain.
    Contains 1 POU-specific domain.
  • Post-translational
    modifications
    Phosphorylated by PRKDC.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • FLJ42836 antibody
    • NF A1 antibody
    • NF-A1 antibody
    • Oct 1 antibody
    • Oct 1B antibody
    • Oct-1 antibody
    • OCT1 antibody
    • Octamer binding protein 1 antibody
    • Octamer binding transcription factor 1 antibody
    • Octamer-binding protein 1 antibody
    • Octamer-binding transcription factor 1 antibody
    • OTF 1 antibody
    • OTF-1 antibody
    • OTF1 antibody
    • OTTHUMP00000032348 antibody
    • OTTHUMP00000032350 antibody
    • OTTHUMP00000032351 antibody
    • PO21 antibody
    • PO2F1 antibody
    • PO2F1_HUMAN antibody
    • POU class 2 homeobox 1 antibody
    • POU domain class 2 transcription factor 1 antibody
    • POU domain, class 2, transcription factor 1 antibody
    • POU2F1 antibody
    see all

Images

  • Immunofluorescent analysis of HeLa cells labeling Oct-1 with ab167483 at 10 µg/ml.

  • All lanes : Anti-Oct-1 antibody (ab167483) at 1 µg/ml

    Lane 1 : Oct-1 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Predicted band size: 76 kDa

References

ab167483 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167483.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up