Overview

  • Product name
  • Description
    Rabbit polyclonal to Oct-1
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Chicken, Pig, Xenopus laevis
  • Immunogen

    Recombinant fragment corresponding to Human Oct-1 aa 15-290.
    Sequence:

    GDGNTGTQTNGLDFQKQPVPVGGAISTAQAQAFLGHLHQVQLAGTSLQAA AQSLNVQSKSNEESGDSQQPSQPSQQPSVQAAIPQTQLMLAGGQITGLTL TPAQQQLLLQQAQAQAQLLAAAVQQHSASQQHSAAGATISASAATPMTQI PLSQPIQIAQDLQQLQQLQQQNLNLQQFVLVHPTTNLQPAQFIISQTPQG QQGLLQAQNLLTQLPQ


    Database link: P14859

  • Positive control
    • HeLa, HL-60, K562, Jurkat, Raji and mouse craniofacial cell lysates.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab180749 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 76 kDa.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

Target

  • Function
    Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3') and activates the promoters of the genes for some small nuclear RNAs (snRNA) and of genes such as those for histone H2B and immunoglobulins. Modulates transcription transactivation by NR3C1, AR and PGR (By similarity). In case of human herpes simplex virus (HSV) infection, POU2F1 forms a multiprotein-DNA complex with the viral transactivator protein VP16 and HCFC1 thereby enabling the transcription of the viral immediate early genes.
  • Tissue specificity
    Ubiquitous. Isoform 2 is lymphocyte-specific.
  • Sequence similarities
    Belongs to the POU transcription factor family. Class-2 subfamily.
    Contains 1 homeobox DNA-binding domain.
    Contains 1 POU-specific domain.
  • Post-translational
    modifications
    Phosphorylated by PRKDC.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • FLJ42836 antibody
    • NF A1 antibody
    • NF-A1 antibody
    • Oct 1 antibody
    • Oct 1B antibody
    • Oct-1 antibody
    • OCT1 antibody
    • Octamer binding protein 1 antibody
    • Octamer binding transcription factor 1 antibody
    • Octamer-binding protein 1 antibody
    • Octamer-binding transcription factor 1 antibody
    • OTF 1 antibody
    • OTF-1 antibody
    • OTF1 antibody
    • OTTHUMP00000032348 antibody
    • OTTHUMP00000032350 antibody
    • OTTHUMP00000032351 antibody
    • PO21 antibody
    • PO2F1 antibody
    • PO2F1_HUMAN antibody
    • POU class 2 homeobox 1 antibody
    • POU domain class 2 transcription factor 1 antibody
    • POU domain, class 2, transcription factor 1 antibody
    • POU2F1 antibody
    see all

Images

  • Anti-Oct-1 antibody (ab180749) at 1/500 dilution + HeLa cell lysate

    Predicted band size : 76 kDa
  • All lanes : Anti-Oct-1 antibody (ab180749) at 1/500 dilution

    Lane 1 : HL-60 cell lysate
    Lane 2 : K562 cell lysate
    Lane 3 : HeLa cell lysate
    Lane 4 : Jurkat cell lysate
    Lane 5 : Raji cell lysate
    Lane 6 : Mouse craniofacial cell lysate


    Predicted band size : 76 kDa

References

ab180749 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180749.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up