Overview

  • Product nameAnti-Oct-2 antibody
    See all Oct-2 primary antibodies
  • Description
    Rabbit polyclonal to Oct-2
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to Human Oct-2 aa 1-50 (N terminal).
    Sequence:

    MVHSSMGAPEIRMSKPLEAEKQGLDSPSEHTDTERNGPDTNHQNPQNKTS


    Database link: P09086

  • Positive control
    • HepG2 cell lysate

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab49247 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1.25 µg/ml. Detects a band of approximately 41 kDa (predicted molecular weight: 51 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1:62500.

Target

  • FunctionTranscription factor that specifically binds to the octamer motif (5'-ATTTGCAT-3'). Regulates transcription in a number of tissues in addition to activating immunoglobulin gene expression. Modulates transcription transactivation by NR3C1, AR and PGR. Isoform 5 activates the U2 small nuclear RNA (snRNA) promoter.
  • Tissue specificityIsoform 3 is B-cell specific. Isoform 5 is expressed in B-cells and the immunoglobulin-expressing T-cell line MOLT-4, but not in the T-cell line BW5147.
  • Sequence similaritiesBelongs to the POU transcription factor family. Class-2 subfamily.
    Contains 1 homeobox DNA-binding domain.
    Contains 1 POU-specific domain.
  • Cellular localizationCytoplasm. Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • class 2 antibody
    • Lymphoid restricted immunoglobulin octamer binding protein antibody
    • Lymphoid-restricted immunoglobulin octamer-binding protein NF-A2 antibody
    • NF A2 antibody
    • Oct 2 antibody
    • Oct-2 antibody
    • Octamer binding transcription factor 2 antibody
    • Octamer-binding protein 2 antibody
    • Octamer-binding transcription factor 2 antibody
    • OTF-2 antibody
    • OTF2 antibody
    • PO2F2_HUMAN antibody
    • POU domain antibody
    • POU domain class 2 transcription factor 2 antibody
    • POU2F2 antibody
    • transcription factor 2 antibody
    see all

Anti-Oct-2 antibody images

  • Anti-Oct-2 antibody (ab49247) at 1.25 µg/ml + HepG2 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution
    Developed using the ECL technique

    Predicted band size : 51 kDa
    Observed band size : 41 kDa (why is the actual band size different from the predicted?)
    Gel concentration: 12%

References for Anti-Oct-2 antibody (ab49247)

ab49247 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab49247.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"