Overview

  • Product nameAnti-Oct4 antibody
    See all Oct4 primary antibodies
  • Description
    Rabbit polyclonal to Oct4
  • Tested applicationsSuitable for: ELISA, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cow, Pig, Chimpanzee
  • Immunogen

    Synthetic peptide corresponding to Human Oct4 aa 114-163.
    Sequence:

    PCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYT

  • Positive control
    • Jurkat cell lysate.

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab49091 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA 1/62500.
WB Use a concentration of 1.25 µg/ml. Detects a band of approximately 39 kDa (predicted molecular weight: 39 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionTranscription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Forms a trimeric complex with SOX2 on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206. Critical for early embryogenesis and for embryonic stem cell pluripotency.
  • Tissue specificityExpressed in developing brain. Highest levels found in specific cell layers of the cortex, the olfactory bulb, the hippocampus and the cerebellum. Low levels of expression in adult tissues.
  • Sequence similaritiesBelongs to the POU transcription factor family. Class-5 subfamily.
    Contains 1 homeobox DNA-binding domain.
    Contains 1 POU-specific domain.
  • Developmental stageHighly expressed in undifferentiated embryonic stem cells and expression decreases gradually after embryoid body (EB) formation.
  • DomainThe POU-specific domain mediates interaction with PKM2.
  • Post-translational
    modifications
    Sumoylation enhances the protein stability, DNA binding and transactivation activity. Sumoylation is required for enhanced YES1 expression.
    Ubiquitinated; undergoes 'Lys-63'-linked polyubiquitination by WWP2 leading to proteasomal degradation.
  • Cellular localizationNucleus. Expressed in a diffuse and slightly punctuate pattern.
  • Information by UniProt
  • Database links
  • Alternative names
    • Octamer binding transcription factor 4 antibody
    • MGC22487 antibody
    • Oct 3 antibody
    • Oct 4 antibody
    • Oct-3 antibody
    • Oct-4 antibody
    • OCT3 antibody
    • Oct4 antibody
    • Octamer binding protein 3 antibody
    • Octamer binding protein 4 antibody
    • Octamer binding transcription factor 3 antibody
    • Octamer-binding protein 3 antibody
    • Octamer-binding protein 4 antibody
    • Octamer-binding transcription factor 3 antibody
    • OTF 3 antibody
    • OTF 4 antibody
    • OTF-3 antibody
    • OTF3 antibody
    • OTF4 antibody
    • PO5F1_HUMAN antibody
    • POU class 5 homeobox 1 antibody
    • POU domain class 5 transcription factor 1 antibody
    • POU domain transcription factor OCT4 antibody
    • POU domain, class 5, transcription factor 1 antibody
    • POU-type homeodomain-containing DNA-binding protein antibody
    • POU5F1 antibody
    see all

Anti-Oct4 antibody images

  • Anti-Oct4 antibody (ab49091) at 1.25 µg/ml (in 5% skimmed milk/PBS) + Jurkat cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 39 kDa
    Observed band size : 39 kDa
    Additional bands at : 35 kDa (possible isoform).

References for Anti-Oct4 antibody (ab49091)

This product has been referenced in:
  • Li Y  et al. BMP4-directed trophoblast differentiation of human embryonic stem cells is mediated through a ?Np63+ cytotrophoblast stem cell state. Development 140:3965-76 (2013). Human . Read more (PubMed: 24004950) »
  • Kaeffer B  et al. Non-invasive exploration of neonatal gastric epithelium by using exfoliated epithelial cells. PLoS One 6:e25562 (2011). ICC/IF ; Human . Read more (PubMed: 22028779) »

See all 2 Publications for this product

Product Wall

There are currently no Abreviews or Questions for ab49091.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"