Overview

  • Product nameAnti-ODF3L1 antibody
  • Description
    Rabbit polyclonal to ODF3L1
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Guinea pig
  • Immunogen

    Synthetic peptide, corresponding to a region within N terminal amino acids 1-50 of Human ODF3L1 (NP_787077);

    MKLPKGTRSSVYFAQHPEKEPLPSRQEVKQTPVIMAKIKGPGPAKYLRPS

  • Positive control
    • Placenta Lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab81513 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 31 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay 1:62500.

Target

  • RelevanceThe exact function of ODF3L1 remains unknown
  • Database links
  • Alternative names
    • MGC48986 antibody
    • ODF3L1 antibody
    • outer dense fiber of sperm tails 3-like 1 antibody
    • Outer dense fiber protein 3-like protein 1 antibody

Anti-ODF3L1 antibody images

  • Anti-ODF3L1 antibody (ab81513) at 1 µg/ml (in 5% skim milk / PBS buffer) + Placenta Lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 31 kDa
    Observed band size : 31 kDa

References for Anti-ODF3L1 antibody (ab81513)

ab81513 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab81513.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"