Overview

  • Product name
    Anti-ODF3L1 antibody
  • Description
    Rabbit polyclonal to ODF3L1
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Guinea pig
  • Immunogen

    Synthetic peptide, corresponding to a region within N terminal amino acids 1-50 of Human ODF3L1 (NP_787077);

    MKLPKGTRSSVYFAQHPEKEPLPSRQEVKQTPVIMAKIKGPGPAKYLRPS

  • Positive control
    • Placenta Lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab81513 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 31 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay 1:62500.

Target

  • Relevance
    The exact function of ODF3L1 remains unknown
  • Database links
  • Alternative names
    • MGC48986 antibody
    • ODF3L1 antibody
    • outer dense fiber of sperm tails 3-like 1 antibody
    • Outer dense fiber protein 3-like protein 1 antibody

Images

  • Anti-ODF3L1 antibody (ab81513) at 1 µg/ml (in 5% skim milk / PBS buffer) + Placenta Lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 31 kDa
    Observed band size : 31 kDa

References

ab81513 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab81513.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up