Overview

  • Product nameAnti-ODF4 antibody
  • Description
    Rabbit polyclonal to ODF4
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide, corresponding to a region within N terminal amino acids 2-51 (

    DAEYSGNEFPRSEGERDQHQRPGKERKSGEAGWGTGELGQDGRLLSSTLS

    ) of Human ODF4 (NP_694552)

  • Positive control
    • Human fetal thymus lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab89796 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 29 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceComponent of the outer dense fibers (ODF) of spermatozoa which could be involved in sperm tail structure, sperm movement and general organization of cellular cytoskeleton
  • Cellular localizationCell Membrane
  • Database links
  • Alternative names
    • hOPPO1 antibody
    • MGC138215 antibody
    • MGC138219 antibody
    • OPPO1 antibody
    • Outer dense fiber of sperm tails protein 4 antibody
    • Outer dense fiber protein 4 antibody
    • Testis specific protein oppo 1 antibody
    see all

Anti-ODF4 antibody images

References for Anti-ODF4 antibody (ab89796)

ab89796 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab89796.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"