Overview

  • Product nameAnti-ODR4 antibody
    See all ODR4 primary antibodies
  • Description
    Rabbit polyclonal to ODR4
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Rat
    Predicted to work with: Mouse, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Human
  • Immunogen

    Synthetic peptide corresponding to a region within C-terminal amino acids 275-324 (SGSVNLRGNVRCRAYIHSNRPKVKDAVQAVKRDILNTVADRCEILFEDL L) of Rat ODR4 according to XP_222746.

  • Positive control
    • Rat brain lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferConstituents: 97% PBS, 2% Sucrose
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab123089 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 50 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionMay play a role in the trafficking of a subset of G-protein coupled receptors.
  • Tissue specificityUbiquitously expressed.
  • Sequence similaritiesBelongs to the ODR-4 family.
  • Cellular localizationMembrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • C1orf27 antibody
    • Chromosome 1 open reading frame 27 antibody
    • hODR-4 antibody
    • LAG1-interacting protein antibody
    • Odorant response abnormal 4 antibody
    • ODR 4 antibody
    • odr4 antibody
    • ODR4_HUMAN antibody
    • Protein odr-4 homolog antibody
    • Transactivated by transforming growth factor beta protein 1 antibody
    • TTG1 antibody
    see all

Anti-ODR4 antibody images

  • Anti-ODR4 antibody (ab123089) at 1 µg/ml + Rat brain lysate at 10 µg

    Predicted band size : 50 kDa

References for Anti-ODR4 antibody (ab123089)

ab123089 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab123089.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"