Anti-Olfr110 antibody - C-terminal (ab177327)

Overview

  • Product name
    Anti-Olfr110 antibody - C-terminal
  • Description
    Rabbit polyclonal to Olfr110 - C-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Cow, Cat, Dog, Human, Pig
  • Immunogen

    Synthetic peptide within Mouse Olfr110 aa 261-310 (C terminal). The exact sequence is proprietary.
    Sequence:

    RPISSYSLEKDRLISVLYSVVTPMLNPVIYTLRNKDIKEAVKAIGRKWQP


    Database link: NP_666440

  • Positive control
    • Mouse spleen lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Constituents: 2% Sucrose, 98% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab177327 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 36 kDa.Can be blocked with Olfr110 peptide (ab208292).

Target

Images

  • Anti-Olfr110 antibody - C-terminal (ab177327) at 1 µg/ml + Mouse spleen lysate at 10 µg

    Predicted band size: 36 kDa

References

ab177327 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177327.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up