Overview

  • Product name
    Anti-OOEP antibody
  • Description
    Rabbit polyclonal to OOEP
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Baboon
  • Immunogen

    Recombinant fragment corresponding to Human OOEP aa 88-146.
    Sequence:

    SGNLVEITVFGRPRVQNRVKSMLLCLAWFHREHRARAEKMKHLEKNLKAH ASDPHSPQD


    Database link: A6NGQ2

  • Positive control
    • Human ovary tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab185478 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/10 - 1/20. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    As a member of the subcortical maternal complex (SCMC), plays an essential role for zygotes to progress beyond the first embryonic cell divisions.
  • Sequence similarities
    Belongs to the KHDC1 family.
    Contains 1 KH domain.
  • Domain
    Contains an atypical KH domain with amino acid changes at critical sites, suggesting that it may not bind RNA.
  • Cellular localization
    Cytoplasm. In the subcortical cytoplasm of early embryos from the 1-cell to the blastocyst stages. From the 2-cell stage, still detected in the subcortex, but excluded from cell-cell contact regions.
  • Information by UniProt
  • Database links
  • Alternative names
    • C6orf156 antibody
    • FLOPED antibody
    • HOEP19 antibody
    • KH homology domain-containing protein 2 antibody
    • KHDC2 antibody
    • Oocyte expressed protein antibody
    • Oocyte- and embryo-specific protein 19 antibody
    • Oocyte-expressed protein homolog antibody
    • OOEP antibody
    • OOEP_HUMAN antibody
    see all

Images

  • Immunohistochemistry analysis of paraffin-embedded Human ovary tissue labeling OOEP with ab185478 at a 1/10 dilution. 

References

ab185478 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185478.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up