Anti-OR13D1 antibody - N-terminal (ab188149)

Overview

  • Product name
    Anti-OR13D1 antibody - N-terminal
    See all OR13D1 primary antibodies
  • Description
    Rabbit polyclonal to OR13D1 - N-terminal
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human OR13D1 aa 12-47 (N terminal).
    Sequence:

    ISIYLNHVLFYTTQQAGDLEHMETRNYSAMTEFFLV


    Database link: Q8NGV5

  • Positive control
    • Human colon tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab188149 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    Odorant receptor.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • O13D1_HUMAN antibody
    • Olfactory receptor 13D1 antibody
    • Olfactory receptor family 13 subfamily D member 1 antibody
    • Olfactory receptor OR9 15 antibody
    • Olfactory receptor OR9-15 antibody
    • OR13D1 antibody
    • OR9 15 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human colon tissue labeling OR13D1 with ab188149 at 1/20 dilution.

References

ab188149 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188149.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up