
  • Product name
  • Description
    Rabbit polyclonal to OR6C68
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 1-50 (MQKSVMRKHTAITTFILLGLTEDPQLQVLLFMFLFITYMLSVTGKLTII A) of Human OR6C68 (NP_001005519).

  • Positive control
    • OVCAR-3 cell lysate



Our Abpromise guarantee covers the use of ab105118 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 35 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


Anti-OR6C68 antibody images

  • Anti-OR6C68 antibody (ab105118) at 1 µg/ml + OVCAR-3 cell lysate at 10 µg

    Predicted band size : 35 kDa

References for Anti-OR6C68 antibody (ab105118)

ab105118 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab105118.
Please use the links above to contact us or submit feedback about this product.


Sign up