Anti-Ornithine Carbamoyltransferase antibody [OTI8A1] (ab180401)

Overview

  • Product name
    Anti-Ornithine Carbamoyltransferase antibody [OTI8A1]
    See all Ornithine Carbamoyltransferase primary antibodies
  • Description
    Mouse monoclonal [OTI8A1] to Ornithine Carbamoyltransferase
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human Ornithine Carbamoyltransferase aa 33-354. Mitochondrial Ornithine carbamoyltransferase (NP_000522)
    Sequence:

    NKVQLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQKGEYLPLLQGKSL GMIFEKRSTRTRLSTETGFALLGGHPCFLTTQDIHLGVNESLTDTARVLS SMADAVLARVYKQSDLDTLAKEASIPIINGLSDLYHPIQILADYLTLQEH YSSLKGLTLSWIGDGNNILHSIMMSAAKFGMHLQAATPKGYEPDASVTKL AEQYAKENGTKLLLTNDPLEAAHGGNVLITDTWISMGQEEEKKKRLQAFQ GYQVTMKTAKVAASDWTFLHCLPRKPEEVDDEVFYSPRSLVFPEAENRKW TIMAVMVSLLTDYSPQLQKPKF


    Database link: P00480

  • Positive control
    • Ornithine Carbamoyltransferase transfected HEK293T cell lysate.
  • General notes

    The clone number has been updated from 8A1 to OTI8A1, both clone numbers name the same clone.

    This product was changed from ascites to tissue culture supernatant on 29th May 2018. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.

Properties

Applications

Our Abpromise guarantee covers the use of ab180401 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 39 kDa.

Target

Images

  • All lanes : Anti-Ornithine Carbamoyltransferase antibody [OTI8A1] (ab180401) at 1/2000 dilution

    Lane 1 : Non-transfected HEK293T cell lysate
    Lane 2 : Lysate of HEK293T cells transfected with the pCMV6-ENTRY Ornithine Carbamoyltransferase cDNA.

    Predicted band size: 39 kDa



    HEK293T cell lysates were generated from transient transfection of the cDNA clone (RC221568)

References

ab180401 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180401.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up