Anti-Orosomucoid 2 antibody (HRP) (ab193060)

Overview

  • Product name
    Anti-Orosomucoid 2 antibody (HRP)
    See all Orosomucoid 2 primary antibodies
  • Description
    Rabbit polyclonal to Orosomucoid 2 (HRP)
  • Host species
    Rabbit
  • Conjugation
    HRP
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human Orosomucoid 2 aa 19-201.
    Sequence:

    QIPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQEIQATFFY FTPNKTEDTIFLREYQTRQNQCFYNSSYLNVQRENGTVSRYEGGREHVAH LLFLRDTKTLMFGSYLDDEKNWGLSFYADKPETTKEQLGEFYEALDCLCI PRSDVMYTDWKKDKCEPLEKQHEKERKQEEGES


    Database link: P19652

Properties

Applications

Our Abpromise guarantee covers the use of ab193060 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/50 - 1/800. Predicted molecular weight: 24 kDa.

Target

  • Relevance
    Orosomucoid 2 is a key acute phase plasma protein. Because of its increase due to acute inflammation, this protein is classified as an acute-phase reactant. The specific function of this protein has not yet been determined; however Orosomucoid 2 appears to function in modulating the activity of the immune system during the acute-phase reaction.
  • Cellular localization
    Secreted
  • Database links
  • Alternative names
    • AGP B' antibody
    • AGP 2 antibody
    • AGP B antibody
    • AGP2 antibody
    • Alpha 1 acid glycoprotein 2 antibody
    • Alpha 1 acid glycoprotein type 2 antibody
    • OMD 2 antibody
    • ORM 2 antibody
    • Orosomucoid2 antibody
    see all

References

ab193060 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193060.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up