Overview

  • Product nameAnti-OSGIN1 antibody
    See all OSGIN1 primary antibodies
  • Description
    Rabbit polyclonal to OSGIN1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within the N terminal amino acids 144-193 (

    PGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTWK

    ) of Human OSGIN1 (NP_037502).

  • Positive control
    • MCF7 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab90128 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 61 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceOSGIN1 (Oxidative stress-induced growth inhibitor 1) regulates the differentiation and proliferation of normal cells through the regulation of cell death.
  • Database links
  • Alternative names
    • 1700012B18Rik antibody
    • BDGI antibody
    • Bone marrow stromal cell derived growth inhibitor antibody
    • huOKL38 antibody
    • OKL 38 antibody
    • OKL38 antibody
    • OSGIN 1 antibody
    • OTTHUMP00000174992 antibody
    • OTTHUMP00000174993 antibody
    • Ovary kidney and liver protein 38 antibody
    • Oxidative stress induced growth inhibitor 1 antibody
    • Pregnancy induced growth inhibitor antibody
    • Pregnancy induced growth inhibitor OKL38 antibody
    see all

Anti-OSGIN1 antibody images

  • Anti-OSGIN1 antibody (ab90128) at 1 µg/ml (5% skim milk / PBS buffer) + MCF7 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 61 kDa

References for Anti-OSGIN1 antibody (ab90128)

ab90128 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab90128.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"