Overview

  • Product name
  • Description
    Rabbit polyclonal to OSGIN1
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within the N terminal amino acids 144-193 (

    PGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTWK

    ) of Human OSGIN1 (NP_037502).

  • Positive control
    • MCF7 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab90128 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 61 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Relevance
    OSGIN1 (Oxidative stress-induced growth inhibitor 1) regulates the differentiation and proliferation of normal cells through the regulation of cell death.
  • Database links
  • Alternative names
    • 1700012B18Rik antibody
    • BDGI antibody
    • Bone marrow stromal cell derived growth inhibitor antibody
    • huOKL38 antibody
    • OKL 38 antibody
    • OKL38 antibody
    • OSGIN 1 antibody
    • OTTHUMP00000174992 antibody
    • OTTHUMP00000174993 antibody
    • Ovary kidney and liver protein 38 antibody
    • Oxidative stress induced growth inhibitor 1 antibody
    • Pregnancy induced growth inhibitor antibody
    • Pregnancy induced growth inhibitor OKL38 antibody
    see all

Images

  • Anti-OSGIN1 antibody (ab90128) at 1 µg/ml (5% skim milk / PBS buffer) + MCF7 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 61 kDa

References

ab90128 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab90128.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up