Overview

  • Product name
  • Description
    Rabbit polyclonal to OSMR
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat OSMR aa 503-749. (Expressed in E.coli).
    Sequence:

    HISANNSAGASPESLVVLSSHSGHEEVHEKTIKGIKNGFNISWEPVSGDA IGYVVDWCAHSQTQRCDLQWKNVGPNITSTIITSDAFEPGVRYNFRIFER SVEENVRLVEKQRGYTQELAPSVNPGVTIHNLTPNSFSLKWQDYASDFQS GFIKGYLVYLKSKELQCNPNWERTVLSDKSVLCKYDVDDPETKTLTVENL RPESLYEFLVTPYTSAGQGPNETYTKVTTPDVRSHMLLQIILPMTLG


    Database link: Q65Z14

  • Positive control
    • WB: Recombinant rat OSMR protein; Rat serum. IHC-P: Rat liver tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab232684 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 109 kDa.

Target

  • Function
    Associates with IL31RA to form the IL31 receptor. Binds IL31 to activate STAT3 and possibly STAT1 and STAT5. Capable of transducing OSM-specific signaling events.
  • Tissue specificity
    Expressed at relatively high levels in all neural cells as well as fibroblast, epithelial and a variety of tumor cell lines.
  • Involvement in disease
    Amyloidosis, primary localized cutaneous, 1 (PLCA1) [MIM:105250]: A primary amyloidosis characterized by localized cutaneous amyloid deposition. This condition usually presents with itching (especially on the lower legs) and visible changes of skin hyperpigmentation and thickening that may be exacerbated by chronic scratching and rubbing. Primary localized cutaneous amyloidosis is often divided into macular and lichen subtypes although many affected individuals often show both variants coexisting. Lichen amyloidosis characteristically presents as a pruritic eruption of grouped hyperkeratotic papules with a predilection for the shins, calves, ankles and dorsa of feet and thighs. Papules may coalesce to form hyperkeratotic plaques that can resemble lichen planus, lichen simplex or nodular prurigo. Macular amyloidosis is characterized by small pigmented macules that may merge to produce macular hyperpigmentation, sometimes with a reticulate or rippled pattern. In macular and lichen amyloidosis, amyloid is deposited in the papillary dermis in association with grouped colloid bodies, thought to represent degenerate basal keratinocytes. The amyloid deposits probably reflect a combination of degenerate keratin filaments, serum amyloid P component, and deposition of immunoglobulins. Note=The disease is caused by mutations affecting the gene represented in this entry.
  • Sequence similarities
    Belongs to the type I cytokine receptor family. Type 2 subfamily.
    Contains 4 fibronectin type-III domains.
  • Domain
    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • IL-31 receptor subunit beta antibody
    • IL-31R subunit beta antibody
    • IL-31R-beta antibody
    • IL-31RB antibody
    • Interleukin-31 receptor subunit beta antibody
    • MGC140467 antibody
    • MGC150626 antibody
    • MGC150627 antibody
    • MGC75127 antibody
    • Oncostatin M receptor antibody
    • Oncostatin M specific receptor subunit beta antibody
    • Oncostatin M-specific receptor, beta antibody
    • Oncostatin-M-specific receptor subunit beta antibody
    • Osmr antibody
    • OSMR_HUMAN antibody
    • OSMRB antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded rat liver tissue stained for OSMR using ab232684 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-OSMR antibody (ab232684) at 1 µg/ml + Recombinant rat OSMR protein

    Developed using the ECL technique.

    Predicted band size: 109 kDa

  • Anti-OSMR antibody (ab232684) at 1 µg/ml + Rat serum

    Developed using the ECL technique.

    Predicted band size: 109 kDa

References

ab232684 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232684.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up