Anti-OSR1 antibody - N-terminal (ab179612)

Overview

  • Product name
    Anti-OSR1 antibody - N-terminal
  • Description
    Rabbit polyclonal to OSR1 - N-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide within Human OSR1 aa 11-60 (N terminal). The exact sequence is proprietary. (NP_660303).
    Sequence:

    PIHPSLQLTNYSFLQAVNGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYP


    Database link: Q8TAX0

  • Positive control
    • Human thymus tumor lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab179612 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 30 kDa.

Target

  • Relevance
    The OSR1 (odd skipped related 1) gene encodes a zinc-finger transcription factor that is expressed in the germ ring mesendoderm and subsequently in the endoderm and intermediate mesoderm, prior to the expression of definitive kidney or blood/vascular markers. Osr1 expression marks a multi-potent population of intermediate mesoderm that undergoes progressive restriction to an Osr1-dependent nephron progenitor compartment within the mammalian kidney. Osr1 expression is regulated by Runx2 and Ikzf1, which are known as master-gene of osteogenesis and hematopoiesis, respectively.
  • Cellular localization
    Nuclear
  • Database links
  • Alternative names
    • ODD antibody
    • Odd skipped Drosophila homolog antibody
    • Odd skipped homolog antibody
    • Odd skipped related 1 (Drosophila) antibody
    • Odd skipped related 1 antibody
    • Odd skipped related 1 Drosophila antibody
    • Odd1 antibody
    • Protein odd skipped related 1 antibody
    see all

Images

  • Anti-OSR1 antibody - N-terminal (ab179612) at 1 µg/ml + Human thymus tumor lysate at 10 µg

    Predicted band size: 30 kDa

References

ab179612 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunocytochemistry/ Immunofluorescence
Blocking step
BSA as blocking agent for 35 minute(s) · Concentration: 5% · Temperature: 20°C
Sample
Human Cell (differentiated iPSC)
Specification
differentiated iPSC
Permeabilization
Yes - Triton X
Fixative
Paraformaldehyde
Username

Abcam user community

Verified customer

Submitted Mar 09 2015

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up