Anti-Osteopontin antibody [7C5H12] (ab166709)
Key features and details
- Mouse monoclonal [7C5H12] to Osteopontin
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-Osteopontin antibody [7C5H12]
See all Osteopontin primary antibodies -
Description
Mouse monoclonal [7C5H12] to Osteopontin -
Host species
Mouse -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Chimpanzee -
Immunogen
Recombinant fragment corresponding to Human Osteopontin aa 167-314.
Sequence:LRSKSKKFRRPDIQYPDATDEDITSHMESEELNGAYKAIPVAQDLNAPSD WDSRGKDSYETSQLDDQSAETHSHKQSRLYKRKANDESNEHSDVIDSQEL SKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN
Database link: P10451 -
Positive control
- Human recombinant Osteopontin protein; HEK293 cells transfected with recombinant Human Osteopontin fragment (amino acids 167-314); Human prostate cancer, endometrial cancer and pancreas tissues.
-
General notes
This product was changed from ascites to supernatant. Lot no’s high than GR206348-21 are from Tissue Culture Supernatant
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: 99% PBS -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
7C5H12 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab166709 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/500 - 1/2000. Predicted molecular weight: 35 kDa.
|
|
IHC-P | (2) |
1/200 - 1/1000.
|
Notes |
---|
WB
1/500 - 1/2000. Predicted molecular weight: 35 kDa. |
IHC-P
1/200 - 1/1000. |
Target
-
Function
Binds tightly to hydroxyapatite. Appears to form an integral part of the mineralized matrix. Probably important to cell-matrix interaction.
Acts as a cytokine involved in enhancing production of interferon-gamma and interleukin-12 and reducing production of interleukin-10 and is essential in the pathway that leads to type I immunity. -
Tissue specificity
Bone. Found in plasma. -
Sequence similarities
Belongs to the osteopontin family. -
Post-translational
modificationsExtensively phosphorylated on clustered serine residues.
N- and O-glycosylated.
Phosphorylation sites are present in the extracelllular medium. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 6696 Human
- Omim: 166490 Human
- SwissProt: P10451 Human
- Unigene: 313 Human
-
Alternative names
- BNSP antibody
- Bone sialoprotein 1 antibody
- Bone sialoprotein I antibody
see all
Images
-
All lanes : Anti-Osteopontin antibody [7C5H12] (ab166709) at 1/500 dilution
Lane 1 : HEK293 cell lysate
Lane 2 : HEK293 cell lysate, transfected with recombinant Human Osteopontin fragment (amino acids 167-314)
Predicted band size: 35 kDa -
ab166709 staining Osteopontin in human colon (smooth muscle cells) tissue sections by Immunohistochemistry (IHC-P - paraformaldehyde-fixed, paraffin-embedded sections). Tissue was fixed with formaldehyde, permeabilized with 0.2% Triton X-100 in PBS and blocked with 5% milk for 30 minutes at room temperature; antigen retrieval was by heat mediation in Tris pH 9.0. Samples were incubated with primary antibody (1/100 in PBS) for 16 hours at 4°C. An undiluted Biotin-conjugated horse anti-mouse IgG polyclonal was used as the secondary antibody.
-
Anti-Osteopontin antibody [7C5H12] (ab166709) at 1/500 dilution + recombinant Human Osteopontin protein
Predicted band size: 35 kDa -
Immunohistochemical analysis of paraffin embedded, DAB-stained Human prostate cancer tissue labeling Osteopontin using ab166709 at a 1/200 dilution.
-
Immunohistochemical analysis of paraffin embedded, DAB-stained Human endometrial cancer tissue, labeling Osteopontin using ab166709 at a 1/200 dilution.
-
Formalin-fixed, paraffin-embedded human pancreas tissue stained for Osteopontin using ab166709 at 1/100 dilution in immunohistochemical analysis.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (15)
ab166709 has been referenced in 15 publications.
- Li L et al. Decreased Spp1 Expression in Acute Myocardial Infarction after Ischemia and Reperfusion Injury. Cardiol Res Pract 2021:3925136 (2021). PubMed: 34426769
- Liu L et al. Development of a Toll-Like Receptor-Based Gene Signature That Can Predict Prognosis, Tumor Microenvironment, and Chemotherapy Response for Hepatocellular Carcinoma. Front Mol Biosci 8:729789 (2021). PubMed: 34621787
- Tierney JW et al. Therapeutic MK2 inhibition blocks pathological vascular smooth muscle cell phenotype switch. JCI Insight 6:N/A (2021). PubMed: 34622803
- Liu J et al. piRNA-36741 regulates BMP2-mediated osteoblast differentiation via METTL3 controlled m6A modification. Aging (Albany NY) 13:23361-23375 (2021). PubMed: 34645714
- Cui Y et al. Collagen particles with collagen-binding bone morphogenetic protein-2 promote vertebral laminar regeneration in infant rabbits. Biomed Mater 15:055008 (2020). PubMed: 32580184