Anti-Otx2 antibody [1313CT817.185.162] (ab191232)

Overview

  • Product name
    Anti-Otx2 antibody [1313CT817.185.162]
    See all Otx2 primary antibodies
  • Description
    Mouse monoclonal [1313CT817.185.162] to Otx2
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human Otx2 aa 1-289.
    Sequence:

    MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPATPRKQRRERTTFTRAQL DVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQ QNGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVS IWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMD CGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGF NSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL


    Database link: P32243

  • Positive control
    • Y79 cell line lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab191232 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/2000. Predicted molecular weight: 32 kDa.

Target

  • Function
    Probably plays a role in the development of the brain and the sense organs. Can bind to the BCD target sequence (BTS): 5'-TCTAATCCC-3'.
  • Tissue specificity
    Expressed in brain.
  • Involvement in disease
    Defects in OTX2 are the cause of microphthalmia syndromic type 5 (MCOPS5) [MIM:610125]. Microphthalmia is a clinically heterogeneous disorder of eye formation, ranging from small size of a single eye to complete bilateral absence of ocular tissues. Up to 80% of cases of microphthalia occur in association with syndromes that include non-ocular abnormalities. MCOPS5 patients manifest unilateral or bilateral microphthalmia/clinical anophthalmia and variable additional features including coloboma, microcornea, cataract, retinal dystrophy, hypoplasia or agenesis of the optic nerve, agenesis of the corpus callosum, developmental delay, joint laxity, hypotonia, and seizures.
  • Sequence similarities
    Belongs to the paired homeobox family. Bicoid subfamily.
    Contains 1 homeobox DNA-binding domain.
  • Developmental stage
    Embryo.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • CPHD6 antibody
    • Homeobox protein OTX2 antibody
    • MCOPS 5 antibody
    • MCOPS5 antibody
    • MGC45000 antibody
    • Orthodenticle 2 antibody
    • Orthodenticle homeobox 2 antibody
    • Orthodenticle homolog 2 (Drosophila) antibody
    • Orthodenticle homolog 2 antibody
    • Orthodenticle2 antibody
    • Otx 2 antibody
    • otx2 antibody
    • OTX2_HUMAN antibody
    see all

Images

  • Anti-Otx2 antibody [1313CT817.185.162] (ab191232) at 1/1000 dilution + Y79 cell line lysate at 35 µg

    Secondary
    Goat anti-mouse IgG H&L (HRP) at 1/3000 dilution

    Predicted band size : 32 kDa

References

ab191232 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191232.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up