Overview

  • Product name
  • Description
    Rabbit polyclonal to Ovalbumin
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IP, IHC-P, WB, ELISAmore details
  • Species reactivity
    Reacts with: Chicken
  • Immunogen

    Full length native protein (purified) corresponding to Chicken Ovalbumin aa 2-386. (Purified from Hen Egg White).
    Sequence:

    GSIGAASMEFCFDVFKELKVHHANENIFYCPIAIMSALAMVYLGAKDSTR TQINKVVRFDKLPGFGDSIEAQCGTSVNVHSSLRDILNQITKPNDVYSFS LASRLYAEERYPILPEYLQCVKELYRGGLEPINFQTAADQARELINSWVE SQTNGIIRNVLQPSSVDSQTAMVLVNAIVFKGLWEKAFKDEDTQAMPFRV TEQESKPVQMMYQIGLFRVASMASEKMKILELPFASGTMSMLVLLPDEVS GLEQLESIINFEKLTEWTSSNVMEERKIKVYLPRMKMEEKYNLTSVLMAM GITDVFSSSANLSGISSAESLKISQAVHAAHAEINEAGREVVGSAEAGVD AASVSEEFRADHPFLFCIKHIATNAVLFFGRCVSP


    Database link: P01012

  • Positive control
    • Ovalbumin protein.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.01% Sodium azide
    Constituents: 0.27% Potassium phosphate, 0.88% Sodium chloride
  • Concentration information loading...
  • Purity
    IgG fraction
  • Purification notes
    ab181688 is an IgG fraction antibody purified from monospecific antiserum by a multi-step process which includes delipidation, salt fractionation and ion exchange chromatography followed by extensive dialysis against the buffer stated above. ab181688 is sterile filtered.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab181688 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP 1/100.
IHC-P 1/300 - 1/2000.
WB 1/500 - 1/2000. Predicted molecular weight: 43 kDa.
ELISA 1/5000 - 1/20000.

Target

  • Function
    Storage protein of egg white. Lack protease inhibitory activity.
  • Tissue specificity
    Major protein of egg white.
  • Sequence similarities
    Belongs to the serpin family. Ov-serpin subfamily.
  • Post-translational
    modifications
    The signal sequence is not cleaved. The functional signal for membrane translocation of ovalbumin becomes accessible when the nascent chain is 50 to 60 residues long. The hydrophobic sequence which lies between residues 27 and 43 folds back on the preceding residues to form an amphipathic hairpin structure which is the signal element recognized by the membrane.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • Allergen Gal d II antibody
    • Egg albumin antibody
    • OVAL_CHICK antibody
    • Ovalbumin antibody
    • Plakalbumin antibody
    • Serpin peptidase inhibitor antibody
    • SERPINB14 antibody
    see all

Images

  • Anti-Ovalbumin antibody (ab181688) at 1/1000 dilution (overnight at 4°C) + Reduced Ovalbumin at 0.005 µg

    Secondary
    Peroxidase rabbit secondary antibody
    30 min at RT at 1/40000 dilution

    Predicted band size: 43 kDa
    Observed band size: 45 kDa (why is the actual band size different from the predicted?)

  • All lanes : Anti-Ovalbumin antibody (ab181688) at 1/5000 dilution

    Lanes 1 & 3 : Ovalbumin protein at 1 µg
    Lanes 2 & 4 : Ovalbumin protein at 0.25 µg

    Secondary
    All lanes : Atto 425 conjugated goat anti rabbit secondary antibody at 1/10000 dilution

    Predicted band size: 43 kDa
    Observed band size: 36 kDa (why is the actual band size different from the predicted?)



    Lane 1 + 2 under reducing conditions; Lane 3 + 4 under non-reducing conditions.

References

This product has been referenced in:
  • O'Dea S  et al. Vector-free intracellular delivery by reversible permeabilization. PLoS One 12:e0174779 (2017). Read more (PubMed: 28358921) »
  • Guest IC & Sell S Bronchial lesions of mouse model of asthma are preceded by immune complex vasculitis and induced bronchial associated lymphoid tissue (iBALT). Lab Invest 95:886-902 (2015). Read more (PubMed: 26006019) »

See all 2 Publications for this product

Customer reviews and Q&As

Application
Immunocytochemistry/ Immunofluorescence
Sample
Mouse Cell (mOVA Islet)
Permeabilization
Yes - TritonX-100
Specification
mOVA Islet
Blocking step
Serum as blocking agent for 1 hour(s) and 30 minute(s) · Concentration: 5% · Temperature: 25°C
Fixative
Paraformaldehyde
Username

Abcam user community

Verified customer

Submitted Dec 20 2017

Abcam has not validated the combination of species/application used in this Abreview.
Application
Immunocytochemistry/ Immunofluorescence
Sample
Mouse Cell (Ovarian Cell line)
Permeabilization
Yes - PBS+0.3% triton-x-100
Specification
Ovarian Cell line
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 24°C
Fixative
Formaldehyde
Username

Abcam user community

Verified customer

Submitted Aug 30 2017

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up