Anti-Ovalbumin antibody (ab181688)
Key features and details
- Rabbit polyclonal to Ovalbumin
- Suitable for: ELISA, IHC-P, IP, WB
- Reacts with: Chicken
- Isotype: IgG
Overview
-
Product name
Anti-Ovalbumin antibody
See all Ovalbumin primary antibodies -
Description
Rabbit polyclonal to Ovalbumin -
Host species
Rabbit -
Tested applications
Suitable for: ELISA, IHC-P, IP, WBmore details -
Species reactivity
Reacts with: Chicken -
Immunogen
Full length native protein (purified) corresponding to Chicken Ovalbumin aa 2-386. (Purified from Hen Egg White).
Sequence:GSIGAASMEFCFDVFKELKVHHANENIFYCPIAIMSALAMVYLGAKDSTR TQINKVVRFDKLPGFGDSIEAQCGTSVNVHSSLRDILNQITKPNDVYSFS LASRLYAEERYPILPEYLQCVKELYRGGLEPINFQTAADQARELINSWVE SQTNGIIRNVLQPSSVDSQTAMVLVNAIVFKGLWEKAFKDEDTQAMPFRV TEQESKPVQMMYQIGLFRVASMASEKMKILELPFASGTMSMLVLLPDEVS GLEQLESIINFEKLTEWTSSNVMEERKIKVYLPRMKMEEKYNLTSVLMAM GITDVFSSSANLSGISSAESLKISQAVHAAHAEINEAGREVVGSAEAGVD AASVSEEFRADHPFLFCIKHIATNAVLFFGRCVSP
Database link: P01012 -
Positive control
- Ovalbumin protein.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.01% Sodium azide
Constituents: 0.27% Potassium phosphate, 0.88% Sodium chloride -
Concentration information loading...
-
Purity
IgG fraction -
Purification notes
ab181688 is an IgG fraction antibody purified from monospecific antiserum by a multi-step process which includes delipidation, salt fractionation and ion exchange chromatography followed by extensive dialysis against the buffer stated above. ab181688 is sterile filtered. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab181688 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ELISA |
Use at an assay dependent concentration.
|
|
IHC-P |
Use at an assay dependent concentration.
|
|
IP |
Use at an assay dependent concentration.
|
|
WB |
1/500 - 1/2000. Predicted molecular weight: 43 kDa.
|
Notes |
---|
ELISA
Use at an assay dependent concentration. |
IHC-P
Use at an assay dependent concentration. |
IP
Use at an assay dependent concentration. |
WB
1/500 - 1/2000. Predicted molecular weight: 43 kDa. |
Target
-
Function
Storage protein of egg white. Lack protease inhibitory activity. -
Tissue specificity
Major protein of egg white. -
Sequence similarities
Belongs to the serpin family. Ov-serpin subfamily. -
Post-translational
modificationsThe signal sequence is not cleaved. The functional signal for membrane translocation of ovalbumin becomes accessible when the nascent chain is 50 to 60 residues long. The hydrophobic sequence which lies between residues 27 and 43 folds back on the preceding residues to form an amphipathic hairpin structure which is the signal element recognized by the membrane. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 396058 Chicken
- SwissProt: P01012 Chicken
-
Alternative names
- Allergen Gal d II antibody
- Egg albumin antibody
- OVAL_CHICK antibody
see all
Images
-
Anti-Ovalbumin antibody (ab181688) at 1/1000 dilution (overnight at 4°C) + Reduced Ovalbumin at 0.005 µg
Secondary
Peroxidase rabbit secondary antibody
30 min at RT at 1/40000 dilution
Predicted band size: 43 kDa
Observed band size: 45 kDa why is the actual band size different from the predicted? -
All lanes : Anti-Ovalbumin antibody (ab181688) at 1/5000 dilution
Lanes 1 & 3 : Ovalbumin protein at 1 µg
Lanes 2 & 4 : Ovalbumin protein at 0.25 µg
Secondary
All lanes : Atto 425 conjugated goat anti rabbit secondary antibody at 1/10000 dilution
Predicted band size: 43 kDa
Observed band size: 36 kDa why is the actual band size different from the predicted?Lane 1 + 2 under reducing conditions; Lane 3 + 4 under non-reducing conditions.
Datasheets and documents
-
SDS download
-
Datasheet download
References (8)
ab181688 has been referenced in 8 publications.
- Gatti L et al. Combining elemental and immunochemical analyses to characterize diagenetic alteration patterns in ancient skeletal remains. Sci Rep 12:5112 (2022). PubMed: 35332214
- Wang H et al. BET inhibitor JQ1 enhances anti-tumor immunity and synergizes with PD-1 blockade in CRC. J Cancer 13:2126-2137 (2022). PubMed: 35517410
- Walsh SM et al. Molecular tracking devices quantify antigen distribution and archiving in the murine lymph node. Elife 10:N/A (2021). PubMed: 33843587
- Pitsch J et al. CD8+ T-Lymphocyte-Driven Limbic Encephalitis Results in Temporal Lobe Epilepsy. Ann Neurol 89:666-685 (2021). PubMed: 33368582
- Chen XY et al. Enhanced paracellular delivery of vaccine by hydrogel microparticles-mediated reversible tight junction opening for effective oral immunization. J Control Release 311-312:50-64 (2019). PubMed: 31465827
- Sonzogni AS et al. Effect of Delivery Platforms Structure on the Epidermal Antigen Transport for Topical Vaccination. Biomacromolecules N/A:N/A (2018). PubMed: 30376297
- O'Dea S et al. Vector-free intracellular delivery by reversible permeabilization. PLoS One 12:e0174779 (2017). PubMed: 28358921
- Guest IC & Sell S Bronchial lesions of mouse model of asthma are preceded by immune complex vasculitis and induced bronchial associated lymphoid tissue (iBALT). Lab Invest 95:886-902 (2015). PubMed: 26006019