Anti-Ovary-specific acidic protein antibody (ab219954)

Overview

  • Product name
    Anti-Ovary-specific acidic protein antibody
    See all Ovary-specific acidic protein primary antibodies
  • Description
    Rabbit polyclonal to Ovary-specific acidic protein
  • Tested applications
    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Ovary-specific acidic protein aa 64-165.
    Sequence:

    YKTVTSDQAKHTEHKTNLKEKTKAEIHPFQGEKENVAETEKASSEAPEEL IVEAEVVDAEESPSATVVVIKEASACPGHVEAAPETTAVSAETGPEVTDA AA


    Database link: Q8TDB4

  • Positive control
    • Human testis tissue; BJ cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab219954 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/2500 - 1/5000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Tissue specificity
    Found in ovary and corneal endothelial cells.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • OSAP antibody
    • C4orf49 antibody
    • CD049_HUMAN antibody
    • CESP 1 antibody
    • Chromosome 4 open reading frame 49 antibody
    • Corneal endothelium-specific protein 1 antibody
    • GS3582 antibody
    • HUMMR antibody
    • Hypoxia up regulated mitochondrial movement regulator antibody
    • MGARP antibody
    • Mitochondria localized glutamic acid rich protein antibody
    • Ovary-specific acidic protein antibody
    • Uncharacterized protein C4orf49 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded human testis tissue labeling Ovary-specific acidic protein with ab219954 at 1/2500 dilution.

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized BJ cells labeling Ovary-specific acidic protein with ab219954 at 4 µg/ml (green).

References

ab219954 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219954.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up