Overview

  • Product nameAnti-OVCA2 antibody
    See all OVCA2 primary antibodies
  • Description
    Rabbit polyclonal to OVCA2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Rat
    Predicted to work with: Mouse, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Human, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 106-155 (

    LDKLGPFDGLLGFSQGAALAAFVCALGQAGDPRFPLPRFIILVSGFCPRG

    ) of Rat OVCA2 (NP_001102506.1).

  • Positive control
    • Rat Lung Lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab125405 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 24 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Tissue specificityUbiquitously expressed.
  • Sequence similaritiesBelongs to the UPF0483 (OVCA2) family.
  • Post-translational
    modifications
    Proteolytically degraded in response to RA and 4HPR treatment in a time- and dose-dependent manner in the promyelocytic leukemia cell line HL60.
  • Information by UniProt
  • Database links
  • FormIt localizes to cytoplasm.
  • Alternative names
    • Candidate tumor suppressor in ovarian cancer 2 antibody
    • Candidate tumor suppressor OVCA2 antibody
    • ovarian cancer associated gene 2 protein antibody
    • Ovarian cancer gene 2 protein antibody
    • Ovarian cancer-associated gene 2 protein antibody
    • ovarian tumor suppressor candidate 2 antibody
    • ovca2 antibody
    • OVCA2_HUMAN antibody
    see all

Anti-OVCA2 antibody images

  • Anti-OVCA2 antibody (ab125405) at 1 µg/ml + Rat Lung Lysate

    Predicted band size : 24 kDa

References for Anti-OVCA2 antibody (ab125405)

ab125405 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab125405.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"