Overview

  • Product nameAnti-OVCH1 antibody
    See all OVCH1 primary antibodies
  • Description
    Rabbit polyclonal to OVCH1
  • Tested applicationsSuitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    antigen sequence: NCIYDAVVIYGDSEEKHKLAKLCGMLTITSIFSSSNMTVIYFKSDGKNRL QGFKARFTIL PSESLNKFEPKLPPQNNPVSTVKAILHDVCGIPPFSPQWL, corresponding to amino acids 472-571 of Human OVCH1 (Q7RTY7).

  • Positive control
    • Human stomach tissue

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferpH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Associated products

Applications

Our Abpromise guarantee covers the use of ab122642 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Anti-OVCH1 antibody images

  • ab122642, at 1/50, staining OVCH1 in paraffin embedded Human stomach by Immunohistochemistry.

References for Anti-OVCH1 antibody (ab122642)

ab122642 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab122642.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"