Overview

  • Product nameAnti-OVOL2 antibody
    See all OVOL2 primary antibodies
  • Description
    Rabbit polyclonal to OVOL2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    A synthetic peptide corresponding to a region within internal sequence amino acids 216 - 265 (CEDCGYTGPTQEDLYLHVNSAHPGSSFLKKTSKKLAALLQGKLTSAHQE N) of Human OVOL2 (NP_067043)

  • Positive control
    • HT1080 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab90692 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 30 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-OVOL2 antibody images

  • Anti-OVOL2 antibody (ab90692) at 1 µg/ml (in 5% skim milk / PBS buffer) + HT1080 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 30 kDa

References for Anti-OVOL2 antibody (ab90692)

ab90692 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab90692.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"