Anti-Oxidoreductase YdhF antibody (Biotin) (ab193491)

Overview

  • Product name
    Anti-Oxidoreductase YdhF antibody (Biotin)
    See all Oxidoreductase YdhF primary antibodies
  • Description
    Rabbit polyclonal to Oxidoreductase YdhF (Biotin)
  • Host species
    Rabbit
  • Conjugation
    Biotin
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Escherichia coli
  • Immunogen

    Recombinant full length protein corresponding to Escherichia coli Oxidoreductase YdhF aa 1-298.
    Sequence:

    MVQRITIAPQGPEFSRFVMGYWRLMDWNMSARQLVSFIEEHLDLGVTTVD HADIYGGYQCEAAFGEALKLAPHLRERMEIVSKCGIATTAREENVIGHYI TDRDHIIKSAEQSLINLATDHLDLLLIHRPDPLMDADEVADAFKHLHQSG KVRHFGVSNFTPAQFALLQSRLPFTLATNQVEISPVHQPLLLDGTLDQLQ QLRVRPMAWSCLGGGRLFNDDYFQPLRDELAVVAEELNAGSIEQVVYAWV LRLPSQPLPIIGSGKIERVRAAVEAETLKMTRQQWFRIRKAALGYDVP


    Database link: P76187

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark.
  • Storage buffer
    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Caprylic Acid - Ammonium Sulfate precipitation
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab193491 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 34 kDa.

Target

References

ab193491 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193491.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up