Overview

  • Product name
  • Description
    Mouse polyclonal to p15 INK4b
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Full length protein corresponding to Human p15 INK4b aa 1-138.
    Sequence:

    MREENKGIPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRA IQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLH RAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD


    Database link: AAH14469

  • Positive control
    • p15 INK4b-transfected 293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab171775 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 15 kDa.

Target

  • Function
    Interacts strongly with CDK4 and CDK6. Potent inhibitor. Potential effector of TGF-beta induced cell cycle arrest.
  • Sequence similarities
    Belongs to the CDKN2 cyclin-dependent kinase inhibitor family.
    Contains 4 ANK repeats.
  • Information by UniProt
  • Database links
  • Alternative names
    • CDK inhibitory protein antibody
    • CDK4B Inhibitor antibody
    • Cdkn2b antibody
    • CDN2B_HUMAN antibody
    • Cyclin dependent kinase 4 inhibitor B antibody
    • Cyclin Dependent Kinase Inhibitor 2B antibody
    • Cyclin dependent kinase inhibitor 2B p15 inhibits CDK4 antibody
    • Cyclin dependent kinases 4 and 6 binding protein antibody
    • Cyclin-dependent kinase 4 inhibitor B antibody
    • INK4B antibody
    • MTS 2 antibody
    • MTS-2 antibody
    • MTS2 antibody
    • Multiple tumor suppressor 2 antibody
    • Multiple Tumor Supressor 2 antibody
    • OTTHUMP00000021154 antibody
    • OTTHUMP00000021155 antibody
    • p14 CDK inhibitor antibody
    • p14 INK4b antibody
    • p14-INK4b antibody
    • P15 antibody
    • p15 CDK inhibitor antibody
    • p15 inhibits CDK4 antibody
    • p15 INK4b antibody
    • p15-INK4b antibody
    • p15INK4B antibody
    • TP 15 antibody
    • TP15 antibody
    see all

Images

  • All lanes : Anti-p15 INK4b antibody (ab171775) at 1 µg/ml

    Lane 1 : p15 INK4b-transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    Goat Anti-Mouse IgG (H&L)-HRP Conjugate secondary antibody at 1/2500 dilution

    Predicted band size : 15 kDa

References

ab171775 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171775.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up