Overview

  • Product name
    Anti-p38 antibody [9F12]
    See all p38 primary antibodies
  • Description
    Mouse monoclonal [9F12] to p38
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Dog, Chimpanzee
  • Immunogen

    Recombinant full length protein corresponding to Human p38 aa 1-360. (Expressed in E.coli) (NP_001306.1).
    Sequence:

    MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRV AVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFN DVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRD LKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHY NQTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTGTPPAYLINRM PSHEARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVP PPLDQEEMES


    Database link: Q16539-2

  • Positive control
    • IHC-P: Human colon carcinoma tissue. WB: A431, A549, HCT-116, HeLa, HEK-293, HepG2, HL-60, HUVEC, Jurkat, MCF7, PC-3, T98G cell lysates; Rat brain lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab59461 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Detects a band of approximately 38 kDa (predicted molecular weight: 41 kDa).
IHC-P 1/1000.

Target

  • Function
    Responds to activation by environmental stress, pro-inflammatory cytokines and lipopolysaccharide (LPS) by phosphorylating a number of transcription factors, such as ELK1 and ATF2 and several downstream kinases, such as MAPKAPK2 and MAPKAPK5. Plays a critical role in the production of some cytokines, for example IL-6. May play a role in stabilization of EPO mRNA during hypoxic stress. Isoform Mxi2 activation is stimulated by mitogens and oxidative stress and only poorly phosphorylates ELK1 and ATF2. Isoform Exip may play a role in the early onset of apoptosis.
  • Tissue specificity
    Brain, heart, placenta, pancreas and skeletal muscle. Expressed to a lesser extent in lung, liver and kidney.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.
    Contains 1 protein kinase domain.
  • Domain
    The TXY motif contains the threonine and tyrosine residues whose phosphorylation activates the MAP kinases.
  • Post-translational
    modifications
    Dually phosphorylated on Thr-180 and Tyr-182, which activates the enzyme.
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • CSAID Binding Protein 1 antibody
    • CSAID binding protein antibody
    • CSAID-binding protein antibody
    • Csaids binding protein antibody
    • CSBP 1 antibody
    • CSBP 2 antibody
    • CSBP antibody
    • CSBP1 antibody
    • CSBP2 antibody
    • CSPB1 antibody
    • Cytokine suppressive anti-inflammatory drug-binding protein antibody
    • EXIP antibody
    • MAP kinase 14 antibody
    • MAP kinase MXI2 antibody
    • MAP kinase p38 alpha antibody
    • MAPK 14 antibody
    • MAPK14 antibody
    • MAX interacting protein 2 antibody
    • MAX-interacting protein 2 antibody
    • Mitogen Activated Protein Kinase 14 antibody
    • Mitogen activated protein kinase p38 alpha antibody
    • Mitogen-activated protein kinase 14 antibody
    • Mitogen-activated protein kinase p38 alpha antibody
    • MK14_HUMAN antibody
    • Mxi 2 antibody
    • MXI2 antibody
    • p38 ALPHA antibody
    • p38 antibody
    • p38 MAP kinase antibody
    • p38 MAPK antibody
    • p38 mitogen activated protein kinase antibody
    • p38ALPHA antibody
    • p38alpha Exip antibody
    • PRKM14 antibody
    • PRKM15 antibody
    • RK antibody
    • SAPK2A antibody
    see all

Images

  • Paraffin-embedded human colon carcinoma tissue stained for p38 using ab59461 at 1/10000 dilution in immunohistochemical analysis. Secondary Antibody: Biotin Goat Anti-Mouse at 1/2000 for 1 hour at RT. Counterstain: Mayer Hematoxylin (purple/blue) nuclear stain at 200 µl for 2 minutes at RT.

  • All lanes : Anti-p38 antibody [9F12] (ab59461) at 1/1000 dilution

    Lane 1 : A431 (human epidermoid carcinoma cell line) cell lysate
    Lane 2 : A549 (human lung carcinoma cell line) cell lysate
    Lane 3 : HCT 116 (human colorectal carcinoma cell line) cell lysate
    Lane 4 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 5 : HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
    Lane 6 : HepG2 (human liver hepatocellular carcinoma cell line) cell lysate
    Lane 7 : Hl-60 (human promyelocytic leukemia cell line) cell lysate
    Lane 8 : HUVEC (human umbilical vein endothelial cell line) cell lysate
    Lane 9 : Jurkat (human T cell leukemia cell line from peripheral blood) cell lysate
    Lane 10 : MCF7 (human breast adenocarcinoma cell line) cell lysate
    Lane 11 : PC-3 (human prostate adenocarcinoma cell line) cell lysate
    Lane 12 : T98G cell lysate
    Lane 13 : Rat brain lysate

    Lysates/proteins at 15 µg per lane.

    Secondary
    Sheep Anti-Mouse IgG: HRP

    Predicted band size : 41 kDa

References

ab59461 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab59461.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up